KEGG   Bacillus subtilis subsp. subtilis 168: BSU03170Help
Entry
BSU03170          CDS       T00010                                 

Gene name
ycgK
Definition
(RefSeq) LysR family transcriptional regulator
  KO
K04761  LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU03170 (ycgK)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    BSU03170 (ycgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 MarR_2 VitK2_biosynth HTH_5 AAA_assoc_C HTH_24
Motif
Other DBs
NCBI-GeneID: 938340
NCBI-ProteinID: NP_388199
Pasteur: BG12009
BSORF: BG12009
UniProt: P94387
Position
341492..342466
Genome map
AA seq 324 aa AA seqDB search
MDIKVMEYAAEIARRQSFTKAAEHLHIAQPSLSQQIKKLEAELGLTLFHRSHGSVTLTPH
GRRFIEKAEDIIRSRDDLLREMQERSQGIGHKLSIGIPAVTGRYLFPPLLKQFLARYPHV
EVQLVEKDPVSLEKMTAKGEVDLSVLSLPIEDERLSITPLLTEPVVLAVPKEKQRWMPPE
LVALIEKALEEDEGRQPCVPIDMVRNVPFILLKEGFGFRRTVLDLCAESGFKPNAAFKTS
HIETAQSLVANGLGVTMAPNMVRRDKDPGVIYLSIQSAPSRTLVFVFLKNRYVSLTAQAF
MELSRESLKQTFDEGCLGNKDENI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaagtgatggaatatgcagcggaaattgcccggcgccaaagctttacaaag
gcggcggaacatcttcatatcgcacagccgtctctcagccagcaaatcaaaaagcttgag
gctgagctggggcttaccctttttcacagatcccatggctctgttacactgacacctcac
ggcaggcgtttcattgaaaaagccgaggacatcattcgttccagagatgatttgcttcgg
gaaatgcaggagcgatcacagggaatcggtcataaattatccatcgggattcctgctgta
acagggagatatctctttcctccgctgctgaagcagtttttggcgcgctatcctcatgtg
gaggttcagcttgttgaaaaagatccggtttcattagagaagatgacggcaaagggagaa
gttgacctttctgttttatccttgcccatcgaggatgaacggctctccattacacccttg
ctcacggaaccggttgttctcgcggtgccgaaggaaaaacaaaggtggatgccgccggaa
ttggtcgcgctgattgagaaagcgctggaagaagatgagggacgccagccgtgtgtgccg
attgacatggtaaggaacgtgccctttattctgttaaaagaaggcttcggctttcgcagg
acagttctcgatctctgtgcggaaagcggctttaagccgaatgctgcctttaagacgagc
catattgaaaccgcccaatctcttgtggctaacggattaggtgtgacaatggcaccgaat
atggtcagaagggataaagatccgggtgtgatctatttatcgattcaatccgcgccatca
cgaaccctcgtctttgtctttttaaagaaccgctatgtcagtctgacggcccaggccttt
atggaactaagccgggaaagtcttaaacaaacgtttgatgaaggctgtctgggaaacaaa
gatgaaaatatttag

DBGET integrated database retrieval system