KEGG   Bacillus subtilis subsp. subtilis 168: BSU03170
Entry
BSU03170          CDS       T00010                                 

Symbol
ycgK
Name
(RefSeq) LysR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_30 VitK2_biosynth HTH_5 MarR_2 HTH_24
Other DBs
NCBI-GeneID: 938340
NCBI-ProteinID: NP_388199
Pasteur: BG12009
BSORF: BG12009
UniProt: P94387 A0A6M4JCM5
Position
341492..342466
AA seq 324 aa
MDIKVMEYAAEIARRQSFTKAAEHLHIAQPSLSQQIKKLEAELGLTLFHRSHGSVTLTPH
GRRFIEKAEDIIRSRDDLLREMQERSQGIGHKLSIGIPAVTGRYLFPPLLKQFLARYPHV
EVQLVEKDPVSLEKMTAKGEVDLSVLSLPIEDERLSITPLLTEPVVLAVPKEKQRWMPPE
LVALIEKALEEDEGRQPCVPIDMVRNVPFILLKEGFGFRRTVLDLCAESGFKPNAAFKTS
HIETAQSLVANGLGVTMAPNMVRRDKDPGVIYLSIQSAPSRTLVFVFLKNRYVSLTAQAF
MELSRESLKQTFDEGCLGNKDENI
NT seq 975 nt   +upstreamnt  +downstreamnt
atggatattaaagtgatggaatatgcagcggaaattgcccggcgccaaagctttacaaag
gcggcggaacatcttcatatcgcacagccgtctctcagccagcaaatcaaaaagcttgag
gctgagctggggcttaccctttttcacagatcccatggctctgttacactgacacctcac
ggcaggcgtttcattgaaaaagccgaggacatcattcgttccagagatgatttgcttcgg
gaaatgcaggagcgatcacagggaatcggtcataaattatccatcgggattcctgctgta
acagggagatatctctttcctccgctgctgaagcagtttttggcgcgctatcctcatgtg
gaggttcagcttgttgaaaaagatccggtttcattagagaagatgacggcaaagggagaa
gttgacctttctgttttatccttgcccatcgaggatgaacggctctccattacacccttg
ctcacggaaccggttgttctcgcggtgccgaaggaaaaacaaaggtggatgccgccggaa
ttggtcgcgctgattgagaaagcgctggaagaagatgagggacgccagccgtgtgtgccg
attgacatggtaaggaacgtgccctttattctgttaaaagaaggcttcggctttcgcagg
acagttctcgatctctgtgcggaaagcggctttaagccgaatgctgcctttaagacgagc
catattgaaaccgcccaatctcttgtggctaacggattaggtgtgacaatggcaccgaat
atggtcagaagggataaagatccgggtgtgatctatttatcgattcaatccgcgccatca
cgaaccctcgtctttgtctttttaaagaaccgctatgtcagtctgacggcccaggccttt
atggaactaagccgggaaagtcttaaacaaacgtttgatgaaggctgtctgggaaacaaa
gatgaaaatatttag

DBGET integrated database retrieval system