KEGG   Bacillus subtilis subsp. subtilis 168: BSU03180Help
Entry
BSU03180          CDS       T00010                                 

Gene name
cah
Definition
(RefSeq) cephalosporin-C deacetylase
  KO
K01060  cephalosporin-C deacetylase [EC:3.1.1.41]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00311  Penicillin and cephalosporin biosynthesis
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BSU03180 (cah)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.41  cephalosporin-C deacetylase
     BSU03180 (cah)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AXE1 Peptidase_S9 Hydrolase_4 DLH Peptidase_S15 FSH1 Abhydrolase_1 BAAT_C Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 938341
NCBI-ProteinID: NP_388200
Pasteur: BG11919
BSORF: BG11919
UniProt: P94388
Structure
PDB: 

Position
342538..343494
Genome map
AA seq 318 aa AA seqDB search
MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLT
YKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQ
QSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGG
SQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQ
AMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEY
IPAFQTEKLAFFKQHLKG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcaactattcgatctgccgctcgaccaattgcaaacatataagcctgaaaaaacagca
ccgaaagatttttctgagttttggaaattgtctttggaggaacttgcaaaagtccaagca
gaacctgatttacagccggttgactatcctgctgacggagtaaaagtgtaccgtctcaca
tataaaagcttcggaaacgcccgcattaccggatggtacgcggtgcctgacaaggaaggc
ccgcatccggcgatcgtgaaatatcatggctacaatgcaagctatgatggtgagattcat
gaaatggtaaactgggcactccatggctacgccacattcggcatgcttgtccgcggccag
cagagcagcgaggatacgagtatttcaccgcacggtcacgctttgggctggatgacgaaa
ggaattcttgataaagatacatactattaccgcggtgtttatttggacgccgtccgcgcg
cttgaggtcatcagcagcttcgacgaggttgacgaaacaaggatcggtgtgacaggagga
agccaaggcggaggtttaaccattgccgcagcagcgctgtcagacattccaaaagccgcg
gttgccgattatccttatttaagcaacttcgaacgggccattgatgtggcgcttgaacag
ccgtaccttgaaatcaattccttcttcagaagaaatggcagcccggaaacagaagtgcag
gcgatgaagacactttcatatttcgatattatgaatctcgctgaccgagtgaaggtgcct
gtcctgatgtcaatcggcctgattgacaaggtcacgccgccgtccaccgtgtttgccgcc
tacaatcatttggaaacaaagaaagagctgaaggtgtaccgctacttcggacatgagtat
atccctgcttttcaaactgaaaaacttgctttctttaagcagcatcttaaaggctga

DBGET integrated database retrieval system