KEGG   Bacillus subtilis subsp. subtilis 168: BSU03190Help
Entry
BSU03190          CDS       T00010                                 

Gene name
ycgL
Definition
(RefSeq) hypothetical protein
  KO
K07074  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU03190 (ycgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlaP Polbeta CotH SKA2
Motif
Other DBs
NCBI-GeneID: 938336
NCBI-ProteinID: NP_388201
Pasteur: BG12010
BSORF: BG12010
UniProt: P94389
Position
343578..344360
Genome map
AA seq 260 aa AA seqDB search
MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFIYVPKKEWYFSIEQER
DVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYEAFTTAEQLRKLRTEAF
KPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQWIEKHGTIPPMDFTVLMN
ELVAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEIERIMEAAKELKAEKKDMT
SELNRLLLNTVEEVWKDGGS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaatcattgatgaattaaaacggatcgagcagtcatacggagtcaaaatc
gtgtatgccgtcgagtcaggaagccgcgcatggggatttccctcgcaggatagtgattac
gacgtccgctttatttatgttccgaaaaaggagtggtacttttcaattgagcaggagcgt
gatgtcattgaggaaccgattcacgatttgctggatatcagcggctgggagctgagaaaa
acgcttcggcttttcaaaaagtcaaaccctccgctactcgaatggctgtcctcagacatt
gtgtattatgaagcatttacgaccgcagagcagttaagaaaactccgcacggaggcattt
aagcctgaagcaagcgtgtatcactatatcaatatggcgagaaggaacgtcaaggattat
ctacaaggacaagaggtcaaaattaaaaagtacttctacgttcttcggcctattttggcc
tgccaatggattgaaaagcacggaaccataccgccaatggactttactgttttgatgaat
gaacttgttgctgaacccgagctgaaggctgaaatggaaaccttgcttgaacggaaaaga
agaggggaagagcttgacctcgaagcaagaatcgatgttattcaccaattcattgaaacg
gaaatcgaaagaatcatggaagcggcaaaagaactgaaggcagagaaaaaagatatgaca
tctgaattgaaccgtttgcttttgaatacggttgaagaagtgtggaaggatggaggaagc
tga

DBGET integrated database retrieval system