KEGG   Bacillus subtilis subsp. subtilis 168: BSU03220Help
Entry
BSU03220          CDS       T00010                                 

Gene name
ycgO
Definition
(RefSeq) symporter
  KO
K11928  sodium/proline symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03220 (ycgO)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU03220 (ycgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 938330
NCBI-ProteinID: NP_388204
Pasteur: BG12013
BSORF: BG12013
UniProt: P94392
Position
347150..348571
Genome map
AA seq 473 aa AA seqDB search
MLLIGYFAYKRTSNLTDYMLGGRSLGPAVTALSAGAADMSGWLLMGLPGAMFSTGLSGAW
IVIGLCLGAWANWLYVAPRLRTYTEKAGNSITIPGFLENRFGDQTKLLRLFSGIVILVFF
TFYVSSGMVSGGVLFNSILGMDYHTGLWIVTGVVVAYTLFGGFLAVSWTDFVQGIIMFAA
LILVPIVTFFHTGGAGDTVAEIRSVDPDMFNIFKGTSVLGIISLFAWGLGYFGQPHIIVR
FMAITSVKEIKRARRIGMGWMILSAVGAVLTGLGGIAYYHQRGMTLKDPETIFIQLGNIL
FHPIITGFLISAILAAIMSTISSQLLVTSSSLVEDLYKSMFRRSASDKELVFLGRLAVLA
VSIVALVLAWEKNNTILGLVSYAWAGFGASFGPVVLLSLFWKRMTKWGALAGMIVGAATV
IIWANAGLSDFLYEMIPGFAASLLSVFFVSILTQAPSQAVTDQFNDYQDTMSQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctgctaatcggctactttgcttacaagcgtacgtcgaatctgacggattatatgctg
ggaggacgctctttgggtccggcagtaaccgctctcagtgccggcgctgccgatatgagc
ggctggctgctaatggggcttccgggcgccatgttttctactggtctgagcggcgcttgg
atcgtcatcggactttgccttggagcgtgggcgaactggctttacgtcgcaccacggctg
agaacctatactgaaaaagcggggaattctattacaattcccggattcctggaaaatcgc
ttcggagatcaaacaaagcttctcagactgttttcgggaattgtcattttagtctttttc
acgttttatgtatcgtccggaatggtgtccggcggcgtcttattcaacagcatcttgggg
atggattatcacaccggcctgtggattgtgacgggtgttgttgtggcatataccctgttt
ggcggctttttggcagtcagctggacagattttgttcaggggattattatgtttgccgca
ctcattcttgtgccgatcgttacgtttttccacacgggaggagcaggtgatacagttgct
gaaatccgctctgtagatcctgatatgtttaatattttcaaaggaacgagcgtccttggc
attatttctttgtttgcctgggggctgggatactttggccagccgcatattattgtgcgt
tttatggcgataacgtctgtcaaagagatcaaaagagcgcgcagaattgggatgggctgg
atgattttgtctgcagtaggcgcagtgctgaccggtttgggcggaatcgcttattaccat
cagcgcggcatgacactgaaggacccagagacgatttttattcaattagggaatatcttg
ttccatccgattatcacgggttttctgatttcagcgattttggccgcgattatgagtaca
atttcttcccagctgcttgtgacatcaagctctctggtagaagatttgtataagtcgatg
ttcagacgctcagcttcagataaagaactggtgtttttaggccgactggctgttctggct
gtttcaattgtcgcgttggttctggcttgggagaaaaataacaccatccttggattggtc
agctacgcgtgggcgggcttcggtgcatcattcgggccagttgtactgctcagtctgttt
tggaaacgaatgaccaaatggggggcactcgccggcatgattgtgggagcagcgactgta
atcatttgggcgaatgccggtctttcggactttctgtatgaaatgatacctggttttgct
gcgagtctattatctgtcttttttgtcagcatattgacgcaggctccgtcacaagctgtc
acagaccagttcaacgactaccaagatacaatgtcgcaataa

DBGET integrated database retrieval system