KEGG   Bacillus subtilis subsp. subtilis 168: BSU03230Help
Entry
BSU03230          CDS       T00010                                 

Gene name
ycgP
Definition
(RefSeq) hypothetical protein
  KO
K23253  PucR family transcriptional regulator, proline-responsive transcriptional activator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU03230 (ycgP)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU03230 (ycgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_30 GGDEF_2
Motif
Other DBs
NCBI-GeneID: 938337
NCBI-ProteinID: NP_388205
Pasteur: BG12014
BSORF: BG12014
UniProt: P94393
Position
348724..349959
Genome map
AA seq 411 aa AA seqDB search
MEELLERVFSFSDVDKLIDFISYELQKPVILESADFFLLAYNSYYINHFDSANQQTIFSK
KCPVQIFERFLKDGIIEKLKTEPEPFRVNKIESIGLNQRVVVSAKHKGEVMGYIWIQELD
QNLTDEELDFLYETSFHVGKIIYKTNKLKQEKEEKAEDLIKRAIYQQFTSEKELRREAER
INTVLPSMFSVVILHAANGDGEAVEDLKENIRSYLNLRDKVSHVLTIESNIVIVVASFSQ
KSSVSSAASEFINKLLTHFHFQKIPTPIYIGIGNEYNHLLKLGKSYTEALEVIKAAEITG
NQENIPYEYAKLGIYRYLESIEQKNEFLEYENKDLALLKAKDEESSTELLKTLEIYLLNN
CKTKPAAEQLFIHQNTLNYRIKQITEMTSIDLSDFRTRCQLYLDLMLMKKK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcttttagagagagttttttcattttcagatgttgataagctaattgatttt
attagctatgaactgcaaaagccagtgatactggaaagcgcggatttctttttgttagcc
tataattcttactatattaaccattttgattctgccaaccagcagactattttttcgaaa
aagtgtccggtccagatttttgagaggtttctgaaggacggaattattgaaaaattgaaa
acagagcctgagccttttcgcgtcaataaaattgaaagcattgggttaaaccagagggtg
gtcgtgagtgcaaagcacaaaggggaagtcatgggctacatctggattcaggagctggac
caaaatctgacggatgaagagctcgactttttgtacgagacctccttccatgtcgggaaa
atcatttataaaacgaataaattgaaacaggaaaaggaagaaaaagcagaggatctcatc
aaacgggcgatctatcagcaatttacctctgagaaggaactcagacgggaagctgaaagg
atcaacaccgtgctgccttccatgttttcagttgttatcctgcacgccgcaaatggggat
ggggaagcggttgaggatttaaaggaaaatatcaggtcgtacctgaatttacgggataag
gtcagtcatgtcttaacgatcgaatcaaacattgtcatcgtcgtagcgagtttttcccaa
aaaagctccgtctcctcagcagcttctgagtttattaacaagctgttaacacattttcac
tttcaaaaaatacctacccctatttatatcggtatcggaaacgaatataatcacctatta
aaacttggcaagagctacacagaagcacttgaagtcatcaaagccgcagaaatcaccggc
aatcaggaaaacattccatatgaatatgccaaactcggcatttaccgctatttagaaagc
atcgaacagaaaaatgaatttttagaatacgagaataaagatttagctttattaaaagca
aaagacgaagaaagcagcactgagctgctcaaaaccttggaaatctatctcctcaacaac
tgcaaaacaaaaccagcggcagaacagctgtttattcaccaaaatacattgaattaccgc
atcaaacagattactgagatgacgtcgatcgatttaagcgatttcagaacgcggtgccag
ctctatctcgatttgatgctgatgaaaaagaaataa

DBGET integrated database retrieval system