KEGG   Bacillus subtilis subsp. subtilis 168: BSU03240Help
Entry
BSU03240          CDS       T00010                                 

Gene name
ycgQ
Definition
(RefSeq) hypothetical protein
  KO
K08986  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU03240 (ycgQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1980 DUF898
Motif
Other DBs
NCBI-GeneID: 938334
NCBI-ProteinID: NP_388206
Pasteur: BG12015
BSORF: BG12015
UniProt: P94394
Position
complement(349996..350853)
Genome map
AA seq 285 aa AA seqDB search
MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAILTAVQAYLFIKSPEKS
GHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYVVFLFPLVSGIFFPIATLDSSIVKTKGFS
FKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSKKEISLTDDDFLKGMETI
YNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIADSGVYGMLVEFPKDMDIKD
DEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYVYRGF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtttattggtgctgatgggatttacgtttttcttttatcatctgcatgcctca
ggaaatctaacaaaatatatcaatatgaaatatgcctatctttcctttattgcgatcttc
ctgctggccattctgaccgccgtccaagcatatctatttatcaagtcgcctgaaaaaagc
ggacatcaccatgaccatgattgcgggtgcggccatgatcacgagcatgaccatgaacaa
aacaagccattttatcagcgttatttgatttatgttgtttttctttttcctttggtgtca
ggcatcttcttcccgattgcaacgcttgactcatccatagtcaaaacaaaagggttctcg
tttaaggcgatggagagcggagatcactactcccaaacacagtatttgcggcctgatgcc
agcctttattacgcgcaagacagctatgacaaacaaatgaaacagctgtttaataagtat
tccagcaaaaaagagatttctctgaccgatgacgatttcctaaaaggaatggaaaccatc
tataactatccgggtgaatttctcggacggacgatagaatttcatggatttgcttacaaa
ggaaacgcaattaacaaaaatcagctgttcgtattaaggtttggcatcattcactgtatc
gctgattccggcgtgtacgggatgcttgtggaatttccgaaggacatggacatcaaggat
gatgaatggattcacattaagggcactctggcctcagaatattaccagccattcaagtca
actctccctgtcgtcaaagtaactgactggaataccattaaaaaacctgatgatccgtat
gtttacagaggattttaa

DBGET integrated database retrieval system