KEGG   Bacillus subtilis subsp. subtilis 168: BSU03250Help
Entry
BSU03250          CDS       T00010                                 

Gene name
ycgR
Definition
(RefSeq) hypothetical protein
  KO
K07089  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU03250 (ycgR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsP_1
Motif
Other DBs
NCBI-GeneID: 938335
NCBI-ProteinID: NP_388207
Pasteur: BG12016
BSORF: BG12016
UniProt: P94395
Position
complement(350858..351742)
Genome map
AA seq 294 aa AA seqDB search
MTAQSSFLQLNSIFISILIEAIPFILIGVILSGIIQMFVSEEMIARIMPKNRFLAVLFGA
LAGVLFPACECGIIPITRRLLLKGVPLHAGVAFMLTAPIINPIVLFSTYIAFGNRWSVVF
YRGGLALAVSLIIGVILSYQFKDNQLLKPDEPGHHHHHHGTLLQKLGGTLRHAIDEFFSV
GKYLIIGAFIAAAMQTYVKTSTLLAIGQNDVSSSLVMMGLAFVLSLCSEVDAFIASSFSS
TFSLGSLIAFLVFGAMVDIKNLLMMLAAFKKRFVFLLITYIVVIVLAGSLLVKG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcacaatcatcttttcttcagctgaattctatttttatcagcattttaatagaa
gccattccgtttattctgattggcgtcatactttccggaatcattcaaatgtttgtttct
gaagaaatgattgcaagaatcatgccgaaaaaccgttttctcgccgttttattcggtgcg
ctggccggcgttttatttcccgcctgcgaatgcggcatcatcccgattacgaggcggctt
ctgttaaagggagttcctctgcatgcgggcgttgctttcatgctgaccgcgcctatcatt
aatcctatcgttttattttctacttatattgcgttcgggaatagatggagcgtggtcttt
tacagaggcggactggctctcgccgtttcgctgatcatcggggtcatcttatcctatcaa
tttaaggataaccagcttttaaagcctgatgaacccgggcaccaccatcatcatcacggc
accttgctccaaaaactgggcgggaccttgcggcatgccattgatgaatttttctccgtg
gggaaatatttaatcatcggcgcctttatcgcagccgctatgcagacgtatgtcaaaaca
tccactctgcttgcgatcgggcagaatgatgtatcctcttccctcgtgatgatgggtctg
gcgtttgtcctgtcgctttgttcagaagttgatgcgttcatcgcgtcttccttcagcagc
acgttttcattaggatcgttaatcgcctttctcgtctttggtgcaatggtggatattaag
aatctattgatgatgcttgcggccttcaaaaaacgatttgttttcctgctgattacatac
attgtcgtgattgttttagcgggatcactactggtaaaggggtga

DBGET integrated database retrieval system