KEGG   Bacillus subtilis subsp. subtilis 168: BSU03260
Entry
BSU03260          CDS       T00010                                 

Symbol
ycgS
Name
(RefSeq) hydrolase YcgS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr
Other DBs
NCBI-GeneID: 938332
NCBI-ProteinID: NP_388208
Pasteur: BG12017
BSORF: BG12017
UniProt: P94396 A0A6M4JD26
Position
complement(351842..352696)
AA seq 284 aa
MKRRVETITFDGGTLEYSVTGKGTPILVMHGGHSNCYEEFGYTALIEQGYSIITPSRPGY
GRTSKEIGKSLANACRFYVKLLDHLQIESVHVIAISAGGPSGICFASHYPERVNTLTLQS
AVTKEWLTPKDTEYKLGEILFRPPVEKWIWKLISSLNNAFPRLMFRAMSPQFSTLPFQRI
KSLMNEKDIEAFRKMNSRQRSGEGFLIDLSQTAAVSLKDLQAIICPVLIMQSVYDGLVDL
SHAHHAKEHIRGAVLCLLHSWGHLIWLGKEAAETGSILLGFLES
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaaaagacgagttgaaacgatcaccttcgatggcggtacactagaatattctgtgaca
ggcaagggaactccgatccttgtcatgcatggcgggcattcaaattgttacgaggaattc
ggatacacagcgttgattgaacaagggtattccatcattacgccttcaaggcctggctat
ggacggacgtcaaaagaaattggaaaaagtcttgccaatgcctgccgtttctatgtgaaa
ttattagatcatctacaaatcgagagtgtccatgtgatcgccatctcagcaggagggccg
agcggcatatgctttgcctcacattatccggaaagagtaaatacattgaccctgcaatcc
gcagtcaccaaagagtggctcaccccaaaagacactgaatataaattgggggaaattctc
ttccgcccgccggtggaaaagtggatatggaagctgatttcttccttgaataacgctttc
ccgcgtttgatgtttcgagctatgagcccccaattcagcacgcttccgtttcagcgaatc
aagtccttgatgaatgaaaaagacatagaagcatttcggaaaatgaacagccggcagcgc
tcgggtgaaggatttctgattgacttgtcacaaaccgccgctgtctctttaaaagacctg
caagccatcatatgtcccgtgctgattatgcaaagtgtttatgacggattggttgacttg
tcacatgcacatcatgcaaaagagcacattcgtggcgctgttctctgtttgcttcactca
tggggacacctgatttggctcggaaaagaagctgcagaaacaggcagtatcctactcggc
tttttggaatcctaa

DBGET integrated database retrieval system