KEGG   Bacillus subtilis subsp. subtilis 168: BSU03260Help
Entry
BSU03260          CDS       T00010                                 

Gene name
ycgS
Definition
(RefSeq) hydrolase YcgS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Abhydrolase_4
Motif
Other DBs
NCBI-GeneID: 938332
NCBI-ProteinID: NP_388208
Pasteur: BG12017
BSORF: BG12017
UniProt: P94396
Position
complement(351842..352696)
Genome map
AA seq 284 aa AA seqDB search
MKRRVETITFDGGTLEYSVTGKGTPILVMHGGHSNCYEEFGYTALIEQGYSIITPSRPGY
GRTSKEIGKSLANACRFYVKLLDHLQIESVHVIAISAGGPSGICFASHYPERVNTLTLQS
AVTKEWLTPKDTEYKLGEILFRPPVEKWIWKLISSLNNAFPRLMFRAMSPQFSTLPFQRI
KSLMNEKDIEAFRKMNSRQRSGEGFLIDLSQTAAVSLKDLQAIICPVLIMQSVYDGLVDL
SHAHHAKEHIRGAVLCLLHSWGHLIWLGKEAAETGSILLGFLES
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacgagttgaaacgatcaccttcgatggcggtacactagaatattctgtgaca
ggcaagggaactccgatccttgtcatgcatggcgggcattcaaattgttacgaggaattc
ggatacacagcgttgattgaacaagggtattccatcattacgccttcaaggcctggctat
ggacggacgtcaaaagaaattggaaaaagtcttgccaatgcctgccgtttctatgtgaaa
ttattagatcatctacaaatcgagagtgtccatgtgatcgccatctcagcaggagggccg
agcggcatatgctttgcctcacattatccggaaagagtaaatacattgaccctgcaatcc
gcagtcaccaaagagtggctcaccccaaaagacactgaatataaattgggggaaattctc
ttccgcccgccggtggaaaagtggatatggaagctgatttcttccttgaataacgctttc
ccgcgtttgatgtttcgagctatgagcccccaattcagcacgcttccgtttcagcgaatc
aagtccttgatgaatgaaaaagacatagaagcatttcggaaaatgaacagccggcagcgc
tcgggtgaaggatttctgattgacttgtcacaaaccgccgctgtctctttaaaagacctg
caagccatcatatgtcccgtgctgattatgcaaagtgtttatgacggattggttgacttg
tcacatgcacatcatgcaaaagagcacattcgtggcgctgttctctgtttgcttcactca
tggggacacctgatttggctcggaaaagaagctgcagaaacaggcagtatcctactcggc
tttttggaatcctaa

DBGET integrated database retrieval system