KEGG   Bacillus subtilis subsp. subtilis 168: BSU03270
Entry
BSU03270          CDS       T00010                                 

Symbol
ycgT
Name
(RefSeq) ferredoxin--NADP reductase 1
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU03270 (ycgT)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     BSU03270 (ycgT)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     BSU03270 (ycgT)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO HI0933_like Amino_oxidase Thi4 NAD_binding_8 FAD_oxidored NAD_binding_7 FMO-like NAD_binding_9
Other DBs
NCBI-GeneID: 938327
NCBI-ProteinID: NP_388209
Pasteur: BG12018
BSORF: BG12018
UniProt: O31475 A0A6M3Z7R4
Structure
Position
352858..353868
AA seq 336 aa
MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGKVSLFFPEKIIRDIGG
IPGIAGKQLIEQLKEQAATFDPDIVLNQRVTGFERLDDGTIVLTGSEGKKHYTRTVILAC
GMGTLEVNEFDSEDAARYAGKNLHYGVEKLDAFKGKRVVISGGGDTAVDWANELEPIAAS
VTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEGIKSVTVCHTESGQRKDIE
IDELIINHGFKIDLGPMMEWGLEIEEGRVKADRHMRTNLPGVFVAGDAAFYESKLRLIAG
GFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggctgagaatcaagaggtatatgacgttacgattataggcggggggccgatcgggctg
tttactgctttttactgcgggatgcgggagctgaaaacaaaggtaatcgaatttttgccg
aagctcggagggaaggtgtctttattctttcctgagaaaatcattcgcgatatcggcggc
ataccggggattgcgggaaagcagctgatcgagcagctgaaggagcaggcggcaacgttt
gatcctgatatcgtattgaatcagcgtgtgaccgggtttgaacgcctagatgacggcacc
attgttctgacgggttctgaagggaaaaagcactatacaagaactgtgattttggcttgc
ggcatgggtacacttgaggtcaatgagtttgacagcgaggatgcggcccgatatgcgggc
aaaaatcttcattatggagtggagaagctcgatgcgtttaaagggaaacgcgtggtgata
tcaggcggcggagatactgcggtcgattgggctaatgagcttgaaccgattgcggcgtct
gtgactgtcgttcatcggcgtgaggaattcggcggaatggaaagcagcgtgacgaaaatg
aagcaatcatcggtgcgggtgcttacgccttatcggctggagcagttgaacggagatgaa
gagggcatcaaaagcgtgaccgtttgtcatactgagtctggccagaggaaagacatagaa
attgatgagctgatcattaatcatgggttcaaaattgatctcgggccgatgatggagtgg
gggctggagattgaagaaggaagggtgaaagctgacagacatatgcgaacgaatcttccg
ggcgtgtttgtggcgggcgacgcggctttttatgaaagcaagctgagattgattgccggc
ggatttacggaaggcccgacagcggtcaacagtgccaaggcttatctggaccctaaggcc
gagaatatggcgatgtattccacccatcataaaaaattggtgcataaataa

DBGET integrated database retrieval system