KEGG   Bacillus subtilis subsp. subtilis 168: BSU03280Help
Entry
BSU03280          CDS       T00010                                 

Gene name
nasF
Definition
(RefSeq) uroporphyrinogen-iii C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU03280 (nasF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BSU03280 (nasF)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSU03280 (nasF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-GeneID: 938324
NCBI-ProteinID: NP_388210
Pasteur: BG11098
BSORF: BG11098
UniProt: P42437
Position
complement(353900..355351)
Genome map
AA seq 483 aa AA seqDB search
MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKLLEFASPDCQFIYCGK
LPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGI
TSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLARSVQTLVFYMGVKNL
SYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIV
NFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADLIEWPKWRTENMPVNEEILR
KIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQP
DSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLS
VQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGFTAVQEQDELLAFIHNQHAEKKL
LHT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggcctg
ctcaccatcaaaggaaaacaggcgctcaaggaagcagatgtgattttatatgaccggctc
gccaacccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaa
ctgccaaaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagca
ttaaatgggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtc
ggcgaggaagcagatgctcttcatgagcacggcattcgctatgaaatggtgccgggaatc
acctctggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgca
tcgtcttttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttgac
tgggaagggctggcccgaagcgttcaaacccttgttttttacatgggtgtcaagaacttg
tcttatatttgccagcagcttatttcatacgggaaatcgccttctgtccctgtcattgtc
atccaatggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcag
caaaaagtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtc
aactttcaaacacacagctggtttgaaagcaaaccgctcatcggacggcatttgatggtt
gtgactcatggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgat
ctcatcgagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagaaattcttcga
aagattggcacctttgaagacgtttttttcacatcgcgccgggcggtttgtgaatttttc
agagcactggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagca
tctgagcaagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcct
gattcagagaaacgtcttgttgtcgggagccgccatgcagtggaaaacatgcaaaagcat
gaatcctgttcgttttatatcactcatgaaaacgtcatagatgaccggttcacccacatg
attcagcgtaccatcagtgaatccccgctgcacatggtcatttgcccaaacaagctgtcc
gttcagcaattgatcaatggtggcgaacaaattggcattttgccggaaccgtcagcaagc
cgccctcctatcgtctgcataggcgatgactcagctgccggcatttatggattcacagcc
gtacaagaacaggatgaattgctagctttcatccacaatcaacatgcagagaaaaaactc
cttcacacctga

DBGET integrated database retrieval system