KEGG   Bacillus subtilis subsp. subtilis 168: BSU03310Help
Entry
BSU03310          CDS       T00010                                 

Gene name
nasC
Definition
(RefSeq) assimilatory nitrate reductase catalytic subunit
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU03310 (nasC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BSU03310 (nasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-GeneID: 938321
NCBI-ProteinID: NP_388213
Pasteur: BG11095
BSORF: BG11095
UniProt: P42434
Position
complement(358303..360435)
Genome map
AA seq 710 aa AA seqDB search
MTERLLRYFRDKQQDVQSEKTYDTQCPFCSMQCKMQLVEQTIVTRKKYTAIGIDNPTTQG
RLCIKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNHIKDQVTMIQTEHGHDAMAV
YGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAANQTFGADRGLTNPLSDIP
HTRVIILAGTNIAECQPTIMPYFEKAKENGAYFIAIDPRETATTKIADLHLKIKPGTDAA
LANGLVKIIIDEQLINEDFIQSRTNGFEELKQHTDSLDLNDIAEQTSVSLVDIRKAAVKF
AKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGKPYSGYGAITGQGNGQGAREHG
QKADQLPGYRSIENEEHRAHIAKVWGIHQDELPRKGVSAYEMMEKINDGDIKGLFLMCSN
PAVSSPNANLVKKALRRLTFFVAIDLFISETAKYADVILPASSYLEDEGTMTNVEGRVTL
REASRPCPGEAKHDWQIICDLASALGKGRYFSYTSAEDIFNELREASRGGIADYSGISYG
RLRREGGIHWPCPESDHPGTGRLFTESFAHPDQKAALSVIPNEPPVPKEKPTADYPLYLT
TGRVMSHYLTGVQTRKSAALAARHFESFMEIHPQTAATYNIEDRVLVKIESPRGSITVRS
KLSEQIRKDTVFVPIHWADAQNVNDLIGEALDPACKMPGFKVCAVRIIPI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaacgactgcttagatatttccgtgataaacagcaagacgtccaatcagaaaaa
acatatgacactcaatgcccgttttgcagcatgcagtgcaaaatgcagctcgtggaacaa
accatcgtcacgcgcaaaaagtacactgcgatcgggattgataatcctacgacacagggt
cggctatgcatcaagggcatgaatgctcaccagcatgccttgaactcctcccgcatcacc
cggccgctgctgaagaaaaacggcgagtttatgcctgtttcctgggaagaagcactgaat
catatcaaagaccaagtgacaatgatccaaactgaacacggacatgacgccatggcggta
tacggaagcgcctcgattacaaatgaagaggcgtatttgttagggaagttcgcacgagta
ggcttacagacaaaatacatcgactacaacgggagactttgtatgtccgcagcagccacc
gcagccaaccaaacattcggcgcggacagaggcttaacgaatcctttatcagacatcccc
cacacccgtgtgatcattctggccggcaccaatattgcggaatgccagcctacgattatg
ccgtattttgaaaaagcgaaagaaaacggagcttacttcattgccattgatcctcgtgaa
acagcgacaacgaaaatcgccgatcttcatctgaaaatcaaacccggcacagacgccgcc
cttgccaacggtctcgtcaaaatcatcattgacgaacagcttataaacgaggatttcatt
caatcacgaacaaatggattcgaagagctgaagcagcatactgactcgttggacctgaat
gacatcgccgaacagacgagtgtctcgctggtggatataagaaaagctgctgtgaagttt
gccaaggaaacgtccggcatgctgtttacagcccgcgggattgaacagcaaaccgatgga
acagcggctgtgaaaggcttcttaaacatggtgctgatcacaggaaaaatcggcaaacct
tactcgggctacggggcgatcaccggacaaggcaacgggcaaggcgccagagagcatggc
caaaaagccgatcagcttccaggctaccgttctatcgaaaacgaagaacaccgggcgcat
attgcgaaagtgtggggaatccatcaggatgaactcccgcgaaaaggtgtctcagcctat
gaaatgatggaaaaaatcaatgacggcgacatcaaaggactgttcctcatgtgctccaac
cctgctgtttccagtccaaatgcaaatctcgtgaaaaaggctttaagaagactgacattc
tttgtcgcaatcgatttgtttatttctgagactgcgaaatacgcagatgtgattttacct
gcctcctcttacttagaagatgaaggcaccatgacaaatgtagaaggacgcgtgacatta
agagaagcaagccggccatgccccggcgaagcaaagcatgattggcagatcatttgtgat
ctcgcatccgctctcggcaagggccgctacttttcttatacgtcagcggaggatattttc
aatgaattgagagaagcgagccgaggcgggattgccgattattcaggcatctcatacggc
aggctcagacgtgaaggcggcattcattggccgtgtccggaatctgatcatcccggaact
gggcgcttgtttacagaatcatttgctcatccggatcaaaaagcggcattaagtgtgatt
ccaaacgaaccacctgttccaaaagagaagccgacagccgattatccgctttatttaacg
acaggcagagtcatgtctcactacttaacaggcgtccaaacaagaaaaagcgccgccctt
gccgcgagacattttgaatcgtttatggagatccatccgcaaacagcagcgacctacaat
atcgaggaccgtgtactggtaaaaatagaatcgccgcggggaagcatcaccgtccgcagc
aaattatcagaacaaatcagaaaagataccgtttttgttcccatccattgggcagacgct
caaaatgtgaatgatttaatcggggaagccttagatccagcctgtaaaatgcccggtttt
aaggtatgcgccgtccgaatcatacctatttaa

DBGET integrated database retrieval system