KEGG   Bacillus subtilis subsp. subtilis 168: BSU03340Help
Entry
BSU03340          CDS       T00010                                 

Gene name
yciA
Definition
(RefSeq) GTP cyclohydrolase folE2
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU03340 (yciA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BSU03340 (yciA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1 DUF3091
Motif
Other DBs
NCBI-GeneID: 938325
NCBI-ProteinID: NP_388216
Pasteur: BG12019
BSORF: BG12019
UniProt: P94398
Position
364259..365173
Genome map
AA seq 304 aa AA seqDB search
MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYFFDIQHVGVANVSHPV
TITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQNGWILSFSSLQQFTKE
LAENMDTSSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTYRKDQPFKQRAGISAKVT
TLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLLHAAESNASARLHPVLKRP
DEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECRNEESIHLHDAYAKLCFSKE
VDKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacatacgctgctcccgaaaaaaacggagcgtcttcaatactttggatcggtc
agtccgatcaaaggcgagaaaccagtggaaaaagagaaaatgaaggacctgcaaaatatc
aggaaggattatttttttgacattcagcatgtaggtgtagctaatgtgtcccatccagtc
acaatcacttctgccatgatgcctgccgagcaaacaacggctgcgaactttacaatgact
tgtaatttgccgagaaatcagaaggggattaacatgagccggttaacagagctgctgcaa
gtctatcatcaaaatggctggattctctcattttcctctcttcagcaatttacgaaagag
cttgcagaaaacatggacacatcatctgccacagttgaagtgaggtttccgtggtttttc
gaacggaaaagcccgaagcttgagaaagcgggtttgatgcatgctgatatattcatgtct
gtcacctatcgcaaagatcagccgtttaaacagcgtgccggcatctcagcaaaagtaacg
actctgtgcccttgctccaaggaaatcagcgaatacagtgcccataatcagaggggaacg
gtcagcatttgggcggatattcacccggccgcatcgctgccaagtgatgttaaagctgat
ttgcttcacgccgcagaatcaaatgcttctgcgagactgcatccggtattgaagcggcct
gatgaaaaagccgtgacagaaacggcctatgaaaacccgagatttgttgaggatctcgcc
cggctgattgctgcagatttgtttgagcttgaatgggtgtcagcctttgagattgaatgc
cgaaatgaagaatcgatccatcttcacgatgcctatgcgaagctgtgtttttcgaaggaa
gtggataaaatatga

DBGET integrated database retrieval system