KEGG   Bacillus subtilis subsp. subtilis 168: BSU03350Help
Entry
BSU03350          CDS       T00010                                 

Gene name
yciB
Definition
(RefSeq) L,D-transpeptidase YciB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-GeneID: 938318
NCBI-ProteinID: NP_388217
Pasteur: BG12020
BSORF: BG12020
UniProt: C0SP99
Position
365170..365754
Genome map
AA seq 194 aa AA seqDB search
MKLSLFIIAVLMPVILLSACSDHAEEHASINTKKTVENITDVRKTAKTSIDWTKPSGGEY
PDIKQKHVWIDVNVKEQKAYIKEGSNTIYTMMISSGLDQTKDDATPKGTFYVEPERGEWF
FSEGYQEGAEYWVSWKNHGEFLFHSVPMTKDQKVIKTEAEKLGTKASHGCIRLTIPDAKW
VYENIPEHTKVVIS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctcattattcattattgcagttcttatgccagtcatcctgctgtcagcctgc
tccgatcatgcagaagaacacgcaagtatcaatacaaagaaaacggtcgaaaacataacg
gacgttcgaaaaacagcaaaaacaagcattgattggacaaagccttcgggcggagaatac
ccggatattaaacagaagcatgtctggattgatgtgaatgtgaaggagcagaaggcttac
atcaaggaaggaagcaacaccatctatacaatgatgatttcttctggtcttgatcaaaca
aaagatgatgctacgccaaagggcaccttttatgtagagcctgaacggggagaatggttt
ttctccgaaggataccaggaaggcgcagaatactgggtatcatggaaaaatcacggtgaa
tttttatttcatagtgtgccaatgactaaggatcaaaaagtcatcaaaacggaagcagaa
aaactaggaacgaaagcatctcacggatgtatcaggctgaccattccagatgcgaaatgg
gtatatgaaaatatccctgaacatacaaaagtggtgatcagctga

DBGET integrated database retrieval system