KEGG   Bacillus subtilis subsp. subtilis 168: BSU03359Help
Entry
BSU03359          CDS       T00010                                 

Gene name
yczL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303053
NCBI-ProteinID: YP_003097674
UniProt: C0H3U7
Position
365850..366035
Genome map
AA seq 61 aa AA seqDB search
MKSGKASIKDLAVGKGKDLRWGKGLNAVGVFTDLEIGRQREMSAKSCSTPLYIRRSIQFK
S
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagcggaaaggcatcgattaaggatcttgctgtcggcaaaggcaaggatttgcga
tggggaaaaggattaaacgcggttggagtctttactgatttagaaatcgggcggcagcga
gaaatgagcgcgaaaagctgctctacaccattgtacatacggcgaagtattcaatttaaa
tcgtaa

DBGET integrated database retrieval system