KEGG   Bacillus subtilis subsp. subtilis 168: BSU03370Help
Entry
BSU03370          CDS       T00010                                 

Gene name
yckA
Definition
(RefSeq) amino acid ABC transporter permease protein YckA
  KO
K10009  L-cystine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03370 (yckA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03370 (yckA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    BSU03370 (yckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 938323
NCBI-ProteinID: NP_388219
Pasteur: BG11177
BSORF: BG11177
UniProt: P42399
Position
complement(367305..367985)
Genome map
AA seq 226 aa AA seqDB search
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatagcattcagtgggaatatattttcaacacgaagctggccattgaatcgttc
ccttatgtcataaaaggcattggttatacactgctcatctcttttgtaagcatgtttgcg
ggaactgtgatcggcctgttcatatcactcgccagaatgtctaaacttgctttgttaaga
tggccggcgaagctctatatctcatttatgcgaggcgttccgattttggtgattttgttt
atcctttatttcgggtttccttatatcggcattgaattttccgctgtcacggctgcttta
atcggctttagcctaaacagcgccgcctacattgcggaaattaaccgttcagccatttca
tccgtcgaaaaaggacagtgggaagccgcatcctcgctgggtctttcctattggcagacg
atgaggggcatcattttgccgcaatcgatacgtattgcgctgcctccgcttgccaatgta
ttgctcgacttgatcaaggcgtcctctctcgctgcgatgattacagtgccggaattgctc
cagcatgcgaaaatcatcgggggcagagagtttgattatatgaccatgtatattctgacc
gctctcatttattgggccatctgctccattgccgcggtctttcagaatatccttgagaaa
aaatacgctcattatgtttaa

DBGET integrated database retrieval system