KEGG   Bacillus subtilis subsp. subtilis 168: BSU03370
Entry
BSU03370          CDS       T00010                                 

Symbol
yckA
Name
(RefSeq) amino acid ABC transporter permease protein YckA
  KO
K10009  L-cystine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03370 (yckA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03370 (yckA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BSU03370 (yckA)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938323
NCBI-ProteinID: NP_388219
Pasteur: BG11177
BSORF: BG11177
UniProt: P42399 A0A6M4JID2
Position
complement(367305..367985)
AA seq 226 aa
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
NT seq 681 nt   +upstreamnt  +downstreamnt
atgatcaatagcattcagtgggaatatattttcaacacgaagctggccattgaatcgttc
ccttatgtcataaaaggcattggttatacactgctcatctcttttgtaagcatgtttgcg
ggaactgtgatcggcctgttcatatcactcgccagaatgtctaaacttgctttgttaaga
tggccggcgaagctctatatctcatttatgcgaggcgttccgattttggtgattttgttt
atcctttatttcgggtttccttatatcggcattgaattttccgctgtcacggctgcttta
atcggctttagcctaaacagcgccgcctacattgcggaaattaaccgttcagccatttca
tccgtcgaaaaaggacagtgggaagccgcatcctcgctgggtctttcctattggcagacg
atgaggggcatcattttgccgcaatcgatacgtattgcgctgcctccgcttgccaatgta
ttgctcgacttgatcaaggcgtcctctctcgctgcgatgattacagtgccggaattgctc
cagcatgcgaaaatcatcgggggcagagagtttgattatatgaccatgtatattctgacc
gctctcatttattgggccatctgctccattgccgcggtctttcagaatatccttgagaaa
aaatacgctcattatgtttaa

DBGET integrated database retrieval system