KEGG   Bacillus subtilis subsp. subtilis 168: BSU03390
Entry
BSU03390          CDS       T00010                                 

Symbol
yckC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RDD DUF2070
Other DBs
NCBI-GeneID: 938315
NCBI-ProteinID: NP_388221
Pasteur: BG11179
BSORF: BG11179
UniProt: P42401 A0A6M4JEU1
Position
369236..369691
AA seq 151 aa
MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPMFW
RGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGLGLIASLILIAVREDKR
TLHDLIAGTYVTYATPGEEELNADEEIRKSE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaatatttacaaaccagccggattttggatcagacttggagctgcattgttagactac
attatagtctccgtgccgcttttgctgatctattggctgattacaggaaaagacccaaac
gacagcatgttcatcagtttggttgttctgctgtattctattttgctgccgatgttttgg
cgcggttatcttatcggaaaaaggatctgcggaatcagaatcgtaaaaaaagacggatca
caggtcagtctgttaacaatgtttttacgggttattgtagccggcctggtttactgtata
accttcggactcggcttgatcgccagcctgattctgattgccgtacgagaagacaaacgg
accctgcatgatttaatcgcgggaacatatgtcacttatgcgacaccaggtgaagaggaa
cttaatgctgacgaagagattagaaagagcgaataa

DBGET integrated database retrieval system