KEGG   Bacillus subtilis subsp. subtilis 168: BSU03390Help
Entry
BSU03390          CDS       T00010                                 

Gene name
yckC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD ABC_export DUF2070
Motif
Other DBs
NCBI-GeneID: 938315
NCBI-ProteinID: NP_388221
Pasteur: BG11179
BSORF: BG11179
UniProt: P42401
Position
369236..369691
Genome map
AA seq 151 aa AA seqDB search
MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPMFW
RGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGLGLIASLILIAVREDKR
TLHDLIAGTYVTYATPGEEELNADEEIRKSE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttacaaaccagccggattttggatcagacttggagctgcattgttagactac
attatagtctccgtgccgcttttgctgatctattggctgattacaggaaaagacccaaac
gacagcatgttcatcagtttggttgttctgctgtattctattttgctgccgatgttttgg
cgcggttatcttatcggaaaaaggatctgcggaatcagaatcgtaaaaaaagacggatca
caggtcagtctgttaacaatgtttttacgggttattgtagccggcctggtttactgtata
accttcggactcggcttgatcgccagcctgattctgattgccgtacgagaagacaaacgg
accctgcatgatttaatcgcgggaacatatgtcacttatgcgacaccaggtgaagaggaa
cttaatgctgacgaagagattagaaagagcgaataa

DBGET integrated database retrieval system