KEGG   Bacillus subtilis subsp. subtilis 168: BSU03400Help
Entry
BSU03400          CDS       T00010                                 

Gene name
yckD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2680 PepSY_2
Motif
Other DBs
NCBI-GeneID: 938319
NCBI-ProteinID: NP_388222
Pasteur: BG11180
BSORF: BG11180
UniProt: P42402
Position
369773..370105
Genome map
AA seq 110 aa AA seqDB search
MKRITINIITMFIAAAVISLTGTAEAAEKQQQSPANVTLTDQQKKEIEQLEAEILKKRKD
VISKYVQYGILPKERGEHIKNHLDKHFEMMKQNGFVPKHHPHPHKFEKRH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaataaccatcaacattatcacaatgttcattgcagcggctgtcatttctctg
accggtacagctgaggccgctgaaaaacagcagcagtctcccgcaaatgttacactgaca
gatcagcaaaagaaagagattgaacaactggaagcagagattcttaaaaagcgcaaagac
gtgatctcaaagtatgtacaatacggtatcctgcctaaagaaagaggagaacacatcaaa
aatcacttggacaaacactttgaaatgatgaaacaaaacggctttgttccaaagcaccat
cctcatccgcataaatttgaaaaaagacattaa

DBGET integrated database retrieval system