KEGG   Bacillus subtilis subsp. subtilis 168: BSU03410Help
Entry
BSU03410          CDS       T00010                                 

Gene name
bglC
Definition
(RefSeq) aryl-phospho-beta-d-glucosidase BglC
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU03410 (bglC)
   00500 Starch and sucrose metabolism
    BSU03410 (bglC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU03410 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 938317
NCBI-ProteinID: NP_388223
Pasteur: BG11181
BSORF: BG11181
UniProt: P42403
Position
370259..371692
Genome map
AA seq 477 aa AA seqDB search
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVL
TLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIEAGDMDLLAKGKPDFVGVNY
YQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLRSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatccaccagcatccagaatcttttccgaaacattttttgtggggctctgcttctgca
gcgtaccagattgaaggcgcttggaatgaagatggcaaaggcccttctgtttgggatgtg
tttacgaaaataccgggcaaaacgtttaaaggaaccaatggcgagattgcggttgaccat
tatcaccgatttaaagaagatgtcgctctgatggctgagatggggttaaaagcatatcga
ttttccgtcagctggccacgggtttttccaaaaggaaaaggagagatcaatgaagcaggt
ctagcgttttacgatagtctgattgatgaattgctttctcatcacatcgagccggttctg
actttatatcactgggatttgcctcaagcgcttatggacgaatacggcgggtttgaatcc
agaaacatcatagaggattttaatcactactgtattactctttataaacgttttggagac
agggtgaaatattgggttacgttaaacgaacagaactacaattttaatcacggatttatt
acagccatgcatccgcctggagtgaaagacagaaaacgattttacgaagcaaaccatatt
gcgtttctggctaatgcaaaagccatcgaatcatttagagaatatgtgcctgaaggcaaa
ataggtcctagctttgcttattctccggcttaccctttatcaagtcatccagaggatata
ctggcatttgaaaacgccgaagaatttacgaacaattggtggcttgacatgtattgctgg
ggaacctacccgcaaattccattccgctgcttggaaaaacagggatgggcgccgacaatt
gaagcaggagatatggacctgctcgccaaagggaagcctgattttgtaggtgtcaattat
tatcagacgatcacctatgaacgaaatccgcttgatggtgtgtcagaagggaaaatgaat
acgacaggccaaaagggaaccaatcaggagacggggatacccggagtgttcaaaacgaaa
aaaaatccgcatctgacaacgagcaactgggattggacaattgacccaattgggctgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttataacagagaacggt
ttgggtgaatttgataaagttgaggacggcactgtacaggatgattatcgaattgattat
ttgcgttcgcatcttgagcaatgcagacaagccatcagtgacggtgtcgatttaatcggc
tattgcagctggtcgtttactgatctgttaagctggctgaacggctaccaaaaaagatac
ggatttgtatatgtcaatcgtgatgaagaaagcacatccgatttaaaacgcttgaagaaa
aaaagcttttattggtatcaagatgtcatcaagacaaacggagaaagtttataa

DBGET integrated database retrieval system