KEGG   Bacillus subtilis subsp. subtilis 168: BSU03420Help
Entry
BSU03420          CDS       T00010                                 

Gene name
nin
Definition
(RefSeq) DNA-entry nuclease inhibitor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComJ DUF4876
Motif
Other DBs
NCBI-GeneID: 938312
NCBI-ProteinID: NP_388224
Pasteur: BG10839
BSORF: BG10839
UniProt: P12669
Structure
PDB: 

Position
complement(371729..372127)
Genome map
AA seq 132 aa AA seqDB search
MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADGAISFEAQRNTKAFIL
FRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEMSDL
HADTYIIDAVSV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaatcatggaagccgcaagaactttcgatttcatatcatcaatttactgtattt
caaaaggattctacacctcctgtaatggattggactgacgaagcgattgaaaaaggatat
gctgcggcagacggagccatttcctttgaggcacagcgaaatacaaaggcctttattctt
tttcgcctgaacagttcagaaacagtaaactcctacgaaaaaaaagtgactgttcctttt
catgtcacagaaaacggaattcatattgaaagcatcatgtctaaaagactgtcctttgat
ctgcctaaaggagactatcaattgacatgctggactgtgccggctgaaatgtcagatttg
cacgccgacacttatattattgatgctgtttctgtgtaa

DBGET integrated database retrieval system