KEGG   Bacillus subtilis subsp. subtilis 168: BSU03420
Entry
BSU03420          CDS       T00010                                 

Symbol
nin
Name
(RefSeq) DNA-entry nuclease inhibitor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ComJ DUF4876
Other DBs
NCBI-GeneID: 938312
NCBI-ProteinID: NP_388224
Pasteur: BG10839
BSORF: BG10839
UniProt: P12669 A0A6M4JF18
Structure
Position
complement(371729..372127)
AA seq 132 aa
MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADGAISFEAQRNTKAFIL
FRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEMSDL
HADTYIIDAVSV
NT seq 399 nt   +upstreamnt  +downstreamnt
ttgatcaaatcatggaagccgcaagaactttcgatttcatatcatcaatttactgtattt
caaaaggattctacacctcctgtaatggattggactgacgaagcgattgaaaaaggatat
gctgcggcagacggagccatttcctttgaggcacagcgaaatacaaaggcctttattctt
tttcgcctgaacagttcagaaacagtaaactcctacgaaaaaaaagtgactgttcctttt
catgtcacagaaaacggaattcatattgaaagcatcatgtctaaaagactgtcctttgat
ctgcctaaaggagactatcaattgacatgctggactgtgccggctgaaatgtcagatttg
cacgccgacacttatattattgatgctgtttctgtgtaa

DBGET integrated database retrieval system