KEGG   Bacillus subtilis subsp. subtilis 168: BSU03430Help
Entry
BSU03430          CDS       T00010                                 

Gene name
nucA
Definition
(RefSeq) DNA-entry nuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNase_NucA_NucB DUF4834 Mycobact_memb
Motif
Other DBs
NCBI-GeneID: 938309
NCBI-ProteinID: NP_388225
Pasteur: BG10838
BSORF: BG10838
UniProt: P12667
Position
complement(372154..372597)
Genome map
AA seq 147 aa AA seqDB search
MTTDIIKTILLVIVIIAAAAVGLIKGDFFSADQKTSQTKEYDETMAFPSDRYPETAKHIK
DAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPMAMCKEGGEGASVEYISPA
DNRGAGSWVGHRLTDYPDGTKVLFTIQ
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atcacgacggacatcataaaaacgatacttctcgtcatcgtcatcatagcagctgcagct
gtcggcctgataaaaggagactttttctcagctgatcaaaaaacgtctcaaacgaaagaa
tatgatgaaacaatggccttcccatctgaccggtatcccgaaactgccaagcatattaag
gatgcgataaatgaggggcactcagaggtgtgcactattgacagagacggagctgaagaa
cgccgcgagcaatcattaaaggacgtaccttccaaaaaggggtatgacagagatgaatgg
ccaatggccatgtgcaaagaaggcggtgagggagcttctgtagaatacatttctcccgct
gacaaccgcggagcaggctcttgggtcgggcatcggcttaccgattacccagacggcaca
aaggttttattcacaattcagtaa

DBGET integrated database retrieval system