KEGG   Bacillus subtilis subsp. subtilis 168: BSU03430
Entry
BSU03430          CDS       T00010                                 

Symbol
nucA
Name
(RefSeq) DNA-entry nuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DNase_NucA_NucB Mycobact_memb
Other DBs
NCBI-GeneID: 938309
NCBI-ProteinID: NP_388225
Pasteur: BG10838
BSORF: BG10838
UniProt: P12667 A0A6M4JG55
Position
complement(372154..372597)
AA seq 147 aa
MTTDIIKTILLVIVIIAAAAVGLIKGDFFSADQKTSQTKEYDETMAFPSDRYPETAKHIK
DAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPMAMCKEGGEGASVEYISPA
DNRGAGSWVGHRLTDYPDGTKVLFTIQ
NT seq 444 nt   +upstreamnt  +downstreamnt
atcacgacggacatcataaaaacgatacttctcgtcatcgtcatcatagcagctgcagct
gtcggcctgataaaaggagactttttctcagctgatcaaaaaacgtctcaaacgaaagaa
tatgatgaaacaatggccttcccatctgaccggtatcccgaaactgccaagcatattaag
gatgcgataaatgaggggcactcagaggtgtgcactattgacagagacggagctgaagaa
cgccgcgagcaatcattaaaggacgtaccttccaaaaaggggtatgacagagatgaatgg
ccaatggccatgtgcaaagaaggcggtgagggagcttctgtagaatacatttctcccgct
gacaaccgcggagcaggctcttgggtcgggcatcggcttaccgattacccagacggcaca
aaggttttattcacaattcagtaa

DBGET integrated database retrieval system