KEGG   Bacillus subtilis subsp. subtilis 168: BSU03450Help
Entry
BSU03450          CDS       T00010                                 

Gene name
hxlB
Definition
(RefSeq) 3-hexulose-6-phosphate isomerase
  KO
K08094  6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU03450 (hxlB)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU03450 (hxlB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     BSU03450 (hxlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2 Transglut_core
Motif
Other DBs
NCBI-GeneID: 938313
NCBI-ProteinID: NP_388227
Pasteur: BG11182
BSORF: BG11182
UniProt: P42404
Structure
PDB: 

Position
complement(374603..375160)
Genome map
AA seq 185 aa AA seqDB search
MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAGRSGLMAKSFAMRLMH
MGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSIG
KQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVILKLMEKKGLDSETMFTH
HANLE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactgaatacgtagcggaaattctcaatgagttacacaattcagcagcttat
atttctaatgaagaagctgaccagcttgccgatcacattctttcatcccaccaaattttc
accgcgggtgcggggcggtctggcctgatggcaaaatccttcgcgatgagactgatgcac
atgggcttcaacgcccatatagtaggtgagattctcactccgccgctcgccgaaggagat
ctagttattatcggctcaggatcaggcgagacaaagagcttgattcataccgcagcaaaa
gcaaaaagcttacacggaattgttgccgctttaaccatcaatccggaatcaagcatcgga
aaacaagcggacctcatcatcagaatgcctggttcccctaaagaccagtctaacggaagc
tataaaaccattcagccaatgggatcattatttgaacaaactttgctgctcttctatgat
gcagtgattttaaaactcatggagaaaaaaggtctcgattctgaaactatgttcactcac
cacgcaaaccttgaatag

DBGET integrated database retrieval system