KEGG   Bacillus subtilis subsp. subtilis 168: BSU03460Help
Entry
BSU03460          CDS       T00010                                 

Gene name
hxlA
Definition
(RefSeq) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU03460 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU03460 (hxlA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BSU03460 (hxlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase PEP_mutase QRPTase_C PRAI 4HFCP_synth Ribul_P_3_epim Abdominal-A
Motif
Other DBs
NCBI-GeneID: 938314
NCBI-ProteinID: NP_388228
Pasteur: BG11183
BSORF: BG11183
UniProt: P42405
Position
complement(375166..375798)
Genome map
AA seq 210 aa AA seqDB search
MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVKEIKEAFPQLKVLADL
KIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKKKILVDMINVKDIESRA
KEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTAIAGGIKLDTLPEVIQQK
PDLVIVGGGITSAADKAETASKMKQLIVQG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaattacagcttgcattagacctcgtcaacatcccggaagccattgagcttgtcaaa
gaggtagaacaatacatcgacgtagttgaaatcggaacaccggtcgtcatcaatgaaggc
ctaagagccgttaaagaaataaaagaagcatttcctcaattgaaggttcttgcagacctg
aaaatcatggatgccggaggctacgaaattatgaaagcgtcggaagcaggcgctgacatc
atcaccgttttaggggctacagacgatgcaacgattaaaggcgcagtagaagaagccaaa
aaacaaaagaagaaaatcttagtggacatgattaacgtgaaagatatcgaatcccgtgcg
aaagaaattgacgcactcggtgttgactacatctgcgtccacactggctatgatcttcaa
gcagagggcaaaaactctttcgaagaattaacgacaatcaaaaataccgtaaaaaacgca
aaaaccgcaatcgcgggcggcatcaaacttgatacactgccagaagtgatccagcaaaag
cctgaccttgtcattgtcgggggcggaattacaagcgcagctgataaggcggaaacagct
tcaaaaatgaagcagctgattgtccaaggataa

DBGET integrated database retrieval system