KEGG   Bacillus subtilis subsp. subtilis 168: BSU03470
Entry
BSU03470          CDS       T00010                                 

Symbol
hxlR
Name
(RefSeq) HxlR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HxlR
Other DBs
NCBI-GeneID: 938311
NCBI-ProteinID: NP_388229
Pasteur: BG11184
BSORF: BG11184
UniProt: P42406 A0A6M3Z7A9
Structure
Position
376032..376394
AA seq 120 aa
MSRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLR
ELEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDIDKNVMKESL
NT seq 363 nt   +upstreamnt  +downstreamnt
ttgagccggatggacgacaaaaggtttaattgtgagaaggaattaacgcttgcagtgatt
ggcggtaaatggaaaatgctcattttatggcatttaggaaaagaaggcacaaaacggttc
aatgaattaaaaacattgattcctgatattacgcagaagatcctcgtgaatcagctgaga
gagcttgagcaggatatgattgttcacagggaagtgtatccagttgtcccgccgaaggtt
gaatattctctgaccccgcacggagaaagcctcatgcctattcttgaagccatgtatgag
tgggggaaaggctatatggaattgattgatatcgacaaaaatgtcatgaaagaatcgttg
taa

DBGET integrated database retrieval system