KEGG   Bacillus subtilis subsp. subtilis 168: BSU03500Help
Entry
BSU03500          CDS       T00010                                 

Gene name
comS
Definition
(RefSeq) competence protein S
  KO
K02252  competence protein ComS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU03500 (comS)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU03500 (comS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU03500 (comS)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BSU03500 (comS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComS
Motif
Other DBs
NCBI-GeneID: 938310
NCBI-ProteinID: NP_388232
Pasteur: BG11045
BSORF: BG11045
UniProt: P80355
Position
390880..391020
Genome map
AA seq 46 aa AA seqDB search
MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWREK
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgatcaggcaagcatcttatcagcagcattatcctgtatccccggcccagcgga
gaatgtatatcctcaatcagcttggacaagcaaacacaagctacaacgtccccgctgtac
ttctgctggagggagaagtag

DBGET integrated database retrieval system