KEGG   Bacillus subtilis subsp. subtilis 168: BSU03510Help
Entry
BSU03510          CDS       T00010                                 

Gene name
srfAC
Definition
(RefSeq) surfactin synthase subunit 3
  KO
K15656  surfactin family lipopeptide synthetase C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01054  Nonribosomal peptide structures
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSU03510 (srfAC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU03510 (srfAC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU03510 (srfAC)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Surfactin family lipopeptide synthetase
    BSU03510 (srfAC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding Thioesterase PP-binding AMP-binding_C Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 938308
NCBI-ProteinID: NP_388233
Pasteur: BG10170
BSORF: BG10170
UniProt: Q08787
Structure
PDB: 

Position
398532..402359
Genome map
AA seq 1275 aa AA seqDB search
MSQFSKDQVQDMYYLSPMQEGMLFHAILNPGQSFYLEQITMKVKGSLNIKCLEESMNVIM
DRYDVFRTVFIHEKVKRPVQVVLKKRQFHIEEIDLTHLTGSEQTAKINEYKEQDKIRGFD
LTRDIPMRAAIFKKAEESFEWVWSYHHIILDGWCFGIVVQDLFKVYNALREQKPYSLPPV
KPYKDYIKWLEKQDKQASLRYWREYLEGFEGQTTFAEQRKKQKDGYEPKELLFSLSEAET
KAFTELAKSQHTTLSTALQAVWSVLISRYQQSGDLAFGTVVSGRPAEIKGVEHMVGLFIN
VVPRRVKLSEGITFNGLLKRLQEQSLQSEPHQYVPLYDIQSQADQPKLIDHIIVFENYPL
QDAKNEESSENGFDMVDVHVFEKSNYDLNLMASPGDEMLIKLAYNENVFDEAFILRLKSQ
LLTAIQQLIQNPDQPVSTINLVDDREREFLLTGLNPPAQAHETKPLTYWFKEAVNANPDA
PALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVVALYTKRSLELVIGILGVLKAGAA
YLPVDPKLPEDRISYMLADSAAACLLTHQEMKEQAAELPYTGTTLFIDDQTRFEEQASDP
ATAIDPNDPAYIMYTSGTTGKPKGNITTHANIQGLVKHVDYMAFSDQDTFLSVSNYAFDA
FTFDFYASMLNAARLIIADEHTLLDTERLTDLILQENVNVMFATTALFNLLTDAGEDWMK
GLRCILFGGERASVPHVRKALRIMGPGKLINCYGPTEGTVFATAHVVHDLPDSISSLPIG
KPISNASVYILNEQSQLQPFGAVGELCISGMGVSKGYVNRADLTKEKFIENPFKPGETLY
RTGDLARWLPDGTIEYAGRIDDQVKIRGHRIELEEIEKQLQEYPGVKDAVVVADRHESGD
ASINAYLVNRTQLSAEDVKAHLKKQLPAYMVPQTFTFLDELPLTTNGKVNKRLLPKPDQD
QLAEEWIGPRNEMEETIAQIWSEVLGRKQIGIHDDFFALGGHSLKAMTAASRIKKELGID
LPVKLLFEAPTIAGISAYLKNGGSDGLQDVTIMNQDQEQIIFAFPPVLGYGLMYQNLSSR
LPSYKLCAFDFIEEEDRLDRYADLIQKLQPEGPLTLFGYSAGCSLAFEAAKKLEEQGRIV
QRIIMVDSYKKQGVSDLDGRTVESDVEALMNVNRDNEALNSEAVKHGLKQKTHAFYSYYV
NLISTGQVKADIDLLTSGADFDMPEWLASWEEATTGVYRVKRGFGTHAEMLQGETLDRNA
EILLEFLNTQTVTVS
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatttagcaaggatcaggttcaagatatgtattacctatcgccgatgcaggaa
gggatgctttttcatgccatcctgaatcccggccaaagcttttaccttgaacaaatcacg
atgaaagtaaaaggcagcttgaatatcaaatgtcttgaagaaagcatgaatgtgatcatg
gaccggtacgatgtatttcgtaccgtgttcattcacgaaaaagtaaaaaggcctgtccaa
gtcgtattgaaaaaacggcagttccatatagaagaaatcgatctgacacacttaacgggc
agcgagcaaacagccaaaatcaatgagtacaaagaacaggataagatcaggggttttgat
ttgacgcgggatattccgatgcgggcagccattttcaagaaagctgaagaaagctttgaa
tgggtgtggagctaccaccacattattttggacggatggtgcttcggcatcgtcgtacag
gatctatttaaggtatacaatgctctgcgcgaacaaaagccgtacagcctgccgcccgtc
aaaccgtataaagactacatcaagtggcttgaaaagcaggataaacaagcatcactgcgt
tactggcgcgaatatttagagggctttgaaggacaaacgacgtttgcggagcaaagaaag
aaacaaaaggacggctatgagccgaaagagctgctcttttcactgtcggaggcggaaaca
aaggcctttaccgagcttgcaaaatcgcagcataccactttgagtacggcgctgcaggca
gtctggagcgtattgatcagccgctatcagcagtctggcgatttggccttcggtacagtt
gtttcagggcgtcccgcggaaatcaaaggcgttgaacatatggtcgggctgtttatcaac
gttgtcccgagacgtgtgaagctgtctgagggtatcacatttaacggcttgctcaagcgg
ctgcaggagcaatcgctgcagtccgagccgcatcaatatgtgccgctttatgacatccaa
agccaggccgatcagccgaaactgattgaccacatcattgtttttgagaactatccgctt
caggatgcgaaaaatgaagaaagcagtgaaaacggctttgatatggtggatgttcatgtt
tttgagaagtcgaattatgatctcaacctgatggcttccccgggagatgagatgctgatt
aagcttgcctataatgagaatgtgtttgatgaggcgtttatcctgcgcttgaaatctcag
cttcttacagcaattcagcagctcatccagaatcctgatcagcctgtcagcacgatcaac
ctcgttgacgacagggagagagaatttttgctaaccggcttaaacccgccggctcaagct
catgaaacaaagcctctgacgtattggttcaaggaagcagtgaacgccaatccggatgca
ccggcgcttacgtattccggccagaccctgtcttatcgcgaattagatgaggaagcgaac
cgcattgcacgccggctgcaaaaacacggtgcgggcaaaggctctgttgtagcgctgtac
acgaagcgctcacttgaactggtgatcggcattctcggtgtattaaaggcgggagcagcc
tatctgccggttgatccgaagctgccagaggaccgaatctcgtatatgctggctgacagt
gcggcagcctgtcttctgacgcatcaggagatgaaagaacaagcggctgagctgccgtat
acaggcacaacgctcttcattgatgatcaaacacggtttgaagaacaggcaagcgatcct
gcaaccgcgattgatcctaatgatccggcatatatcatgtacacgtccggcacaaccgga
aagccaaagggcaatatcaccactcatgccaatattcaaggattggtcaagcatgtagac
tacatggcattttctgatcaggatacgttcttgtctgtttcgaattacgcctttgatgca
tttacctttgatttctatgcttctatgctgaatgcggcacggctcattatcgcagatgaa
catacgctgcttgatacagaacggctcacagatctgatcctgcaagagaatgtcaatgtc
atgtttgcgacaaccgcactatttaatcttctcacagatgcgggagaggattggatgaag
gggcttcgctgtatattattcggcggagagcgcgcgtcagtgcctcatgtcagaaaagcg
ctgcggatcatggggccgggcaagctgattaactgctacgggccgactgagggaacagtg
tttgcgacagctcacgtcgtgcatgatctgccggattccatctcctcattgccgatcgga
aagccgatcagcaatgccagtgtttatattctgaatgagcaaagccagctccagccattc
ggggcggtcggtgaactgtgcatcagcggaatgggcgtgtcaaaagggtatgtaaatcgt
gctgacctcacgaaggaaaagtttatcgagaacccgttcaagccgggagaaacgctttac
cgtacaggggatttagcgcgctggctgccggatggaacgattgaatacgccggccgtatt
gacgaccaggtcaaaatacgcggacaccggattgagcttgaagaaatcgaaaagcagctg
caggaatacccaggtgtgaaagatgcggtcgttgtggcggaccgccatgagtctggcgat
gcatcaatcaatgcctaccttgtgaaccgaacgcagctttcagctgaagacgtgaaggcg
cacctgaaaaaacagcttcctgcttacatggtgccgcaaacctttaccttcttggatgag
cttcctttaacgacgaacgggaaagtcaataaacggctgctcccaaaacctgatcaggat
cagctggcggaagaatggattggaccgcggaacgagatggaagaaacaatcgcacaaata
tggtctgaggttctcggcagaaagcaaattggcattcatgacgatttctttgcgctcgga
gggcattccttgaaggccatgaccgccgcgtcccgcatcaagaaagagctcgggattgat
cttccagtgaagcttttgtttgaagcgccgacgatcgccggcatttcagcgtatttgaaa
aacgggggctctgatggcttgcaggatgtaacgataatgaatcaggatcaggagcagatc
attttcgcatttccgccggttctgggctatggccttatgtaccaaaatctgtccagccgc
ttgccgtcatacaagctatgcgcctttgattttattgaggaggaagaccggcttgaccgc
tatgcggatttgatccagaagctgcagccggaagggcctttaacattgtttggatattca
gcgggatgcagcctggcgtttgaagctgcgaaaaagcttgaggaacaaggccgtattgtt
cagcggatcatcatggtggattcctataaaaaacaaggtgtcagtgatctggacggacgc
acggttgaaagtgatgtcgaagcgttgatgaatgtcaatcgggacaatgaagcgctcaac
agcgaagccgtcaaacacggcctcaagcaaaaaacacatgccttttactcatactacgtc
aacctgatcagcacaggccaggtgaaagcagatattgatctgttgacttccggcgctgat
tttgacatgccggaatggcttgcatcatgggaagaagctacaacaggtgtttaccgtgtg
aaaagaggcttcggaacacacgcagaaatgctgcagggcgaaacgctagataggaatgcg
gagattttgctcgaatttcttaatacacaaaccgtaacggtttcataa

DBGET integrated database retrieval system