KEGG   Bacillus subtilis subsp. subtilis 168: BSU03520Help
Entry
BSU03520          CDS       T00010                                 

Gene name
srfAD
Definition
(RefSeq) surfactin synthase thioesterase subunit
  KO
K15657  external thioesterase TEII
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU03520 (srfAD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU03520 (srfAD)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide tailoring proteins
  Thioesterase
   BSU03520 (srfAD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_1 DUF3089 Esterase Abhydrolase_3 PGAP1 YqbF Abhydrolase_5 LCAT Lipase_3
Motif
Other DBs
NCBI-GeneID: 938300
NCBI-ProteinID: NP_388234
Pasteur: BG10171
BSORF: BG10171
UniProt: Q08788
Structure
PDB: 

Position
402388..403116
Genome map
AA seq 242 aa AA seqDB search
MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHGTNQTSAIED
LEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGIFPQAVIISAIQPPHIQ
RKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSDYRALEQFELYDLAQIQS
PVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPII
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactcttcaaatcatttgatgcgtcggaaaaaacacagctcatctgttttccg
tttgccggcggctattcggcgtcgtttcgccctctccatgcttttttgcagggggagtgc
gagatgctcgctgccgagccgccgggacacggcacgaatcaaacgtcagccattgaggat
ctcgaagagctgacggatttgtacaagcaagaactgaaccttcgccctgatcggccgttt
gtgctgttcggacacagtatgggcggaatgatcaccttcaggctggcgcaaaagcttgag
cgtgaaggcatctttccgcaggcggttatcatttctgcaatccagccgcctcatattcag
cggaagaaagtgtcccacctgcctgatgatcagtttctcgatcatattatccaattaggc
ggaatgcccgcagagcttgttgaaaataaggaggtcatgtcctttttcctgccttctttc
cgatcagattaccgggctcttgaacaatttgagctttacgatctggcccagatccagtcg
cctgttcatgtctttaacgggcttgatgataaaaaatgcatacgagatgcggaagggtgg
aagaagtgggcaaaagacatcacattccatcaatttgacggcgggcacatgttcctgctg
tcacaaacggaagaagtcgcagaacggatttttgcgatcttgaatcagcatccgatcatt
caaccgtga

DBGET integrated database retrieval system