KEGG   Bacillus subtilis subsp. subtilis 168: BSU03520
Entry
BSU03520          CDS       T00010                                 

Symbol
srfAD
Name
(RefSeq) surfactin synthase thioesterase subunit
  KO
K15657  external thioesterase TEII
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU03520 (srfAD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU03520 (srfAD)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide tailoring proteins
  Thioesterase
   BSU03520 (srfAD)
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_1 Esterase DUF3089 Abhydrolase_3 PGAP1 Abhydrolase_5 YqbF LCAT Lipase_3
Other DBs
NCBI-GeneID: 938300
NCBI-ProteinID: NP_388234
Pasteur: BG10171
BSORF: BG10171
UniProt: Q08788 A0A6M3ZAH3
Structure
PDB: 
2K2Q 2RON

Position
402388..403116
AA seq 242 aa
MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHGTNQTSAIED
LEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGIFPQAVIISAIQPPHIQ
RKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSDYRALEQFELYDLAQIQS
PVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPII
QP
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagccaactcttcaaatcatttgatgcgtcggaaaaaacacagctcatctgttttccg
tttgccggcggctattcggcgtcgtttcgccctctccatgcttttttgcagggggagtgc
gagatgctcgctgccgagccgccgggacacggcacgaatcaaacgtcagccattgaggat
ctcgaagagctgacggatttgtacaagcaagaactgaaccttcgccctgatcggccgttt
gtgctgttcggacacagtatgggcggaatgatcaccttcaggctggcgcaaaagcttgag
cgtgaaggcatctttccgcaggcggttatcatttctgcaatccagccgcctcatattcag
cggaagaaagtgtcccacctgcctgatgatcagtttctcgatcatattatccaattaggc
ggaatgcccgcagagcttgttgaaaataaggaggtcatgtcctttttcctgccttctttc
cgatcagattaccgggctcttgaacaatttgagctttacgatctggcccagatccagtcg
cctgttcatgtctttaacgggcttgatgataaaaaatgcatacgagatgcggaagggtgg
aagaagtgggcaaaagacatcacattccatcaatttgacggcgggcacatgttcctgctg
tcacaaacggaagaagtcgcagaacggatttttgcgatcttgaatcagcatccgatcatt
caaccgtga

DBGET integrated database retrieval system