KEGG   Bacillus subtilis subsp. subtilis 168: BSU03530Help
Entry
BSU03530          CDS       T00010                                 

Gene name
ycxA
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 938307
NCBI-ProteinID: NP_388235
Pasteur: BG10172
BSORF: BG10172
UniProt: Q08791
Position
403217..404443
Genome map
AA seq 408 aa AA seqDB search
MRTSPRMKWFVLLFTFVFAIGMNSFRNSFQFFMLPMADAFHADRSLISVSVSIFMITTGI
VQFFVGFFIDRFSVRKIMALGAVCISASFLVLPYSPNVHVFSAIYGVLGGIGYSCAVGVT
TQYFISCWFDTHKGLALAILTNANSAGLLLLSPIWAAAPYHAGWQSTYTILGIVMAAVLL
PLLVFGMKHPPHAQAETVKKSYDWRGFWNVMKQSRLIHILYFGVFTCGFTMGIIDAHLVP
ILKDAHVSHVNGMMAAFGAFIIIGGLLAGWLSDLLGSRSVMLSILFFIRLLSLICLLIPI
LGIHHSDLWYFGFILLFGLSYTGVIPLTAASISESYQTGLIGSLLGINFFIHQVAGALSV
YAGGLFFDMTHGYLLIVAVCIVFVGLSAVIELVPFLDKQKAKETHHSI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgtctcccaggatgaaatggtttgtattgctgtttacgtttgttttcgccatc
ggaatgaactcattcagaaattcctttcaattttttatgctgccaatggcagacgccttc
catgccgacaggtcgctgatttcggtttctgtcagcatttttatgatcacaaccggcatc
gtccagttttttgtcggtttttttatcgaccgtttcagtgtcagaaaaattatggcgctg
ggagctgtttgcatcagcgcaagctttttggtgcttccttattcaccgaatgttcatgtg
ttttccgccatttacggtgtgcttggcggaatcgggtattcctgcgcggtcggcgtgacg
acccagtatttcatcagctgttggtttgacacacacaaaggtctggcgcttgctattttg
accaatgccaactctgcgggcctgctgcttctctcgcccatttgggctgcggctccgtat
catgccggctggcagagcacctataccattttgggaatcgtcatggcggctgttctgctg
ccgctcctcgtctttgggatgaagcacccgccacatgcgcaagcggaaactgtgaaaaaa
tcttatgattggcgagggttttggaacgtgatgaagcaatcccgcctcattcatatcctg
tacttcggcgtgtttacttgcggatttacaatgggaattattgatgctcacctcgtcccg
atactgaaggatgcgcatgtctctcatgtcaacggaatgatggccgcgttcggggcattt
atcatcattggcggattattggcgggctggctgtcagatctcctcggcagcagaagcgtc
atgctatccatcttatttttcattcggctgctcagcctcatttgcctgctcattcccatt
ctcggaattcatcacagcgacctttggtacttcgggtttatcctgttattcgggctcagt
tacacaggcgtgatcccgctgaccgcggcgtcaatttcggaaagctatcaaacaggattg
atcggatcgctgttaggcatcaatttctttatccatcaggttgccggagctctcagcgtg
tatgcgggcggtttgttttttgacatgactcatggttatttactgattgtcgctgtgtgc
atcgtgtttgtgggtttatcggctgtaatagagctggtgccgtttttagataaacagaag
gcaaaagaaacccaccattcaatataa

DBGET integrated database retrieval system