KEGG   Bacillus subtilis subsp. subtilis 168: BSU03550Help
Entry
BSU03550          CDS       T00010                                 

Gene name
ycxC
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TPT CRT-like DMT_6 TetR_C_34
Motif
Other DBs
NCBI-GeneID: 938297
NCBI-ProteinID: NP_388237
Pasteur: BG10174
BSORF: BG10174
UniProt: Q08794
Position
complement(405069..406007)
Genome map
AA seq 312 aa AA seqDB search
MVKHQQTPAYIAAILYSFIIGLSFLFVKIALQTAEPFDILAHRFTIAFAAATVPILFGWV
KLSIRVKDVIDILPLALLYPALFFSFQAFGLVYSSSSEAGIIQAAIPIFTMVFAAYVLKE
RPTWTQKGFTVLSVAGVMFIFVMKGVDVESASLKGSLLILLSALSSAMYNTAARKMTQRF
KLTELTYIMSAIGFVVFNAIALVRHGAAGTVGTYFLPFREPGFVLAIVYLGVLSSLVTSF
LSNYTLSRIEAFKMSAFNHVSTIVTMIAGFVILNESLAWYHLAGAVCIMIGVVGSNINLE
KKTKRPGMPAKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacatcagcaaacccccgcttatatagcggctattttatattcgttcattatc
ggtttatcctttctattcgtaaaaatcgcactgcaaacagcagagccgtttgatattttg
gcgcatcggttcaccattgcgtttgctgcggccactgtaccgatcttattcggctgggta
aagctatcaatccgcgtaaaggacgtcattgacattttgccgctcgccctgctgtatccc
gcgttatttttcagctttcaggcattcggccttgtgtactcgtcctcctctgaagcggga
attattcaggcagccattccgattttcacgatggtctttgccgcttatgttttaaaggaa
cgcccaacgtggacgcaaaaggggttcacggttttatccgttgccggcgtcatgtttatt
tttgtgatgaaaggcgttgacgtggaatcagccagcttaaaagggtctttgctgatccta
ttgtccgctttgtcttcagcgatgtacaatactgctgccagaaaaatgacgcagcggttc
aagctgaccgagctcacctacatcatgtcagccatcggctttgtcgtcttcaacgccatc
gcccttgtgcgtcacggagcggcgggaacagtcggcacttattttctgccgttccgggag
cccggcttcgttctcgccattgtgtatttgggcgtgctgtcttcacttgtcacttcattt
ctgtctaactatacgctgtcgcgaattgaggcgtttaaaatgagcgcttttaatcatgta
tctaccattgtgacgatgattgcaggatttgtgattctcaacgaaagcctggcctggtat
catcttgccggggctgtttgtattatgattggcgtggtggggagcaatatcaatctggag
aaaaaaacaaagcgccctggtatgcctgcaaaaaaatga

DBGET integrated database retrieval system