KEGG   Bacillus subtilis subsp. subtilis 168: BSU03560Help
Entry
BSU03560          CDS       T00010                                 

Gene name
ycxD
Definition
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR HTH_36 MarR HTH_11 HTH_41 MarR_2 HTH_Crp_2 HTH_27 Rrf2 Fe_dep_repress HTH_IclR HTH_24 HTH_DeoR PRANC TrmB
Motif
Other DBs
NCBI-GeneID: 938304
NCBI-ProteinID: NP_388238
Pasteur: BG10175
BSORF: BG10175
UniProt: Q08792
Position
406131..407465
Genome map
AA seq 444 aa AA seqDB search
MEKYMSLLTRIEEMMQSTSYQEGDRLPSIRQLSARYQVSKSTVIRALQELEKRHLIYSVP
KSGYYIVKKSGKSKSGQPGPIDFATSAPDPDVFPYLDFQHCINKAIDTYKNDLFIYGTPK
GLPSLIRVLRKLLATQQVFADERHIFITSGVQQALSLLCAMPFPNGKEKIAIEQPGYHLM
VEQLETLGIPAIGVKRTEEGLDIAKVERLFQTESIKFFYTMPRFHNPLGCSLSERDKQEL
VRLAEAYDVYLVEDDYLGDLEENKKADPLYAYDLSSHVIYLKSFSKMMFPGLRVGAAVLP
EALTDTFYAYKKLNDIDCSMISQAALEIYLKSGMYGRHKEKIRDSYKERSLRLHQAIRTH
RQLGSGRFTFSSGQAPCMHTHLVLPQDLPASRVIHRLEKQGVLLEAIDRHYLSDYPKENL
LKINISNVKTEDIERGVKLLMSHL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatatatgagtctattaacgaggatagaggagatgatgcaaagcacctcatat
caagaaggagacaggcttccatctatccgtcagctgtccgcccgctaccaagtcagcaaa
agcacagtgatccgcgcgctgcaggagctggaaaagcgccaccttatctattctgttccg
aaaagcggctattatattgtgaaaaagtcagggaaatcaaaaagcgggcagcctggcccc
atcgactttgccacatctgcgccggatcccgatgtgtttccgtatcttgattttcagcac
tgcatcaacaaagcgattgatacatacaaaaacgatttgtttatttatgggacgccaaag
gggcttccatcactcatccgcgtactccgaaagctcttggccactcaacaggtatttgcg
gatgaacggcatattttcattacatcaggtgtccagcaggcgttatccttgctttgtgcc
atgccgttcccaaatgggaaagagaagatcgccattgaacagccgggctaccatttgatg
gtcgaacagcttgagacacttgggattcccgccatcggggtgaaacgaacggaagaaggg
cttgatatagccaaggttgagcggttatttcaaacagaatcgattaaatttttttatacg
atgccgcgcttccataacccgcttgggtgctcattgtcagagcgtgataaacaggagctt
gtgagactggcagaagcgtatgatgtctatctcgttgaggatgattacctcggtgatctg
gaggaaaataaaaaggcagatccgctgtacgcatatgatctgtcctcacatgtcatctat
ttgaaaagcttctcgaaaatgatgttccccggcctccgcgtgggggcggctgttttgccc
gaagcgctgactgacacgttctatgcgtacaaaaagctgaacgacatcgactgttcgatg
atttctcaagcggcattggagatttacctgaaaagcggtatgtacggcaggcataaggag
aaaatcagagattcttataaagagcggtcgctgaggctacatcaagccattcgaactcac
aggcagctgggaagcggacgctttacgttctccagcgggcaggcaccctgtatgcacacc
catctggtgcttcctcaggatctgcccgcctcaagagtgattcatagactggaaaaacaa
ggggttctccttgaggcgatagaccgtcattatttatcagattatccgaaagaaaatcta
ttaaaaatcaatatttccaatgtgaaaacggaagatattgagcgcggtgtcaagctgttg
atgagccatttataa

DBGET integrated database retrieval system