KEGG   Bacillus subtilis subsp. subtilis 168: BSU03580Help
Entry
BSU03580          CDS       T00010                                 

Gene name
yczE
Definition
(RefSeq) hypothetical protein
  KO
K07149  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU03580 (yczE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane
Motif
Other DBs
NCBI-GeneID: 938302
NCBI-ProteinID: NP_388240
Pasteur: BG12779
BSORF: BG12779
UniProt: O34927
Position
complement(408240..408887)
Genome map
AA seq 215 aa AA seqDB search
MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLFQHFGLTVGQWSIIIG
ALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYTGSIIVFSLGVVLIGYG
VGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFAAWGMGGPIGFGTILTAI
LTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaagaacttgttctgcgctggacattttattttgccggtttgatcattttggct
tttggtgtatccctgacgatagaaggaaaagcactcggcattagtccgtgggatgcattt
cattacagcctgtttcagcacttcgggcttaccgtcggccagtggtccatcattattgga
gcgctcatcgtcggattcacgtcattgtttacgagagcttggccgaaaattggtgccctc
ctgaatatggtgctcattggtgtatttatagattttttcaatttcattctgcctgccctc
tcgacctacacaggctcgatcatcgtcttctctctaggcgtggtgctgattggttacggc
gtcggtgtttatgtatcagcaggccttggcgcggggccgcgtgattcactgatgatgctg
attacagaaaaaaccggctggaatgtgcaatgggtgcggaacggcatggaattaaccatt
ttgtttgcggcatggggcatgggcggaccgatcggttttggcaccattttgaccgccatc
ctcaccggacttattttgcgtttttcattgccccagtcaatccagttgctgaattatgct
gtggcaaggcggacagccgcagtgaaagcatctccgcctgtacactaa

DBGET integrated database retrieval system