KEGG   Bacillus subtilis subsp. subtilis 168: BSU03590Help
Entry
BSU03590          CDS       T00010                                 

Gene name
tcyC
Definition
(RefSeq) L-cystine import ATP-binding protein TcyC
  KO
K10010  L-cystine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03590 (tcyC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03590 (tcyC)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BSU03590 (tcyC)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    BSU03590 (tcyC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_29 AAA_16 AAA_22 RsgA_GTPase ABC_ATPase AAA_18 AAA_15 AAA_28 AAA_24 ATPase_2 NB-ARC T2SSE NACHT DLIC AAA_30 AAA_25 AAA_14 PRK AAA_19 cobW PduV-EutP GvpD AAA_33 RecA G-alpha IstB_IS21 MobB Mg_chelatase TsaE
Motif
Other DBs
NCBI-GeneID: 938294
NCBI-ProteinID: NP_388241
Pasteur: BG11185
BSORF: BG11185
UniProt: P39456
Position
complement(409208..409951)
Genome map
AA seq 247 aa AA seqDB search
MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLRCLNALEIPNRGELAF
DDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVMEGPVQVQKRNKEEVRKE
AIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELMLFDEPTSALDPELVGEVL
KVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQGPPEQIFSAPKEERTQRFL
NRILNPL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccgttaaaggattaaacaaatcattcggtgaaaatgaaattttaaaaaagata
gatatgaagattgaaaaaggaaaagtcatcgccatacttgggccttcaggttcagggaaa
acgacgctgctccgctgcctgaacgctctggagatcccgaatcgcggagagcttgcattt
gatgatttctccatcgatttctccaaaaaggtgaaacaggcggatatcctaaagcttcgc
cgaaaatccggaatggtgtttcaggcgtatcacctgttcccgcaccgcacagccctcgaa
aacgtgatggagggccctgttcaggtgcaaaaacggaacaaagaggaagtcagaaaagaa
gcgattcagcttcttgataaagtcggattgaaggacaaaatggatttatatccgttccag
ctttccggcggccagcagcagcgcgtcggcatcgcccgcgcactggcgatacagcctgag
ctcatgctgtttgacgaaccgacctcagcgcttgatcccgagcttgtcggagaggtgctg
aaggttatcaaggacttggccaatgaaggctggaccatggtcgtcgtgacccacgaaatc
aagttcgcgcaggaggttgcggatgaagtcatcttcatcgacggcggcgttatcgtggag
cagggaccgccggagcaaattttctccgcaccaaaagaagaacggacacagcggttctta
aaccggattttgaacccgctgtaa

DBGET integrated database retrieval system