KEGG   Bacillus subtilis subsp. subtilis 168: BSU03600Help
Entry
BSU03600          CDS       T00010                                 

Gene name
tcyB
Definition
(RefSeq) L-cystine transport system permease protein TcyB
  KO
K10009  L-cystine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03600 (tcyB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03600 (tcyB)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    BSU03600 (tcyB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1129 BRI3BP Colicin_V MHYT
Motif
Other DBs
NCBI-GeneID: 938301
NCBI-ProteinID: NP_388242
Pasteur: BG11186
BSORF: BG11186
UniProt: P42200
Position
complement(409965..410669)
Genome map
AA seq 234 aa AA seqDB search
MFLNNLPALTLGTAIPWDLVQQSFWPILSGGIYYTIPLTILSFIFGMILALITALARMSK
VRPLRWVFSVYVSAIRGTPLLVQLFIIFYLFPAFNVTLDPFPSAVIAFSLNVGAYASEII
RASILSVPKGQWEAGYTIGMTHQKTLFRVILPQAFRVSIPPLSNTFISLIKDTSLASQIL
VAELFRKAQEIGARNLDQILVIYIEAAFIYWIICFLLSLVQHVIERRLDRYVAK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtttctaaataatctgccggcattgacgcttggcacggcgatcccgtgggatctggtg
cagcagtcattctggccgatactttcagggggaatctactatacgattccccttacgatt
ctttcctttatattcggaatgatcctggcgctgattacggcgcttgccagaatgtcgaaa
gtgagacctttgagatgggtgttcagcgtatacgtatccgcaatacgcggcactcctctt
ctcgttcaattgttcatcattttctatctgttcccggcctttaacgtcacattagatcca
tttccaagcgcagttatcgccttttcattaaacgtcggcgcctatgcatctgaaatcatt
cgggcatctattttatccgtgccgaaagggcaatgggaagccggctacacaattggcatg
acacatcaaaaaacgctgttccgcgtcattttgccgcaggcgtttcgtgtgtcgatcccg
ccattatccaatacctttatcagcctgattaaagatacatccctcgcctctcaaattctg
gtcgctgagctgttcagaaaagcccaggaaatcggcgcgcggaatcttgatcaaatttta
gtgatctatattgaagcagcctttatttattggattatctgcttcctgctctcactcgtc
cagcatgtcatcgaacggcgtcttgaccgctacgtggccaaataa

DBGET integrated database retrieval system