KEGG   Bacillus subtilis subsp. subtilis 168: BSU03610Help
Entry
BSU03610          CDS       T00010                                 

Gene name
tcyA
Definition
(RefSeq) L-cystine-binding protein TcyA
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03610 (tcyA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03610 (tcyA)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU03610 (tcyA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    BSU03610 (tcyA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BSU03610 (tcyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Glyco_transf_41 DUF3947
Motif
Other DBs
NCBI-GeneID: 938298
NCBI-ProteinID: NP_388243
Pasteur: BG11187
BSORF: BG11187
UniProt: P42199
Position
complement(410656..411462)
Genome map
AA seq 268 aa AA seqDB search
MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTY
HDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDRED
KYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGM
AQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQ
VNKALKEMKEDGTLSKISKKWFGEDVSK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcattattggctttattcatggtcgtaagtattgcagctcttgcagcttgc
ggagcaggaaatgacaatcagtcaaaagataatgccaaagatggcgatctttgggcttca
attaagaaaaaaggtgtgctcacagtcggaacggaaggaacatatgagccgttcacttac
cacgacaaagacactgataaactgactggctatgatgtcgaagttatcacagaagtcgca
aaacgcctcgggcttaaagtcgactttaaggaaacacaatgggacagtatgtttgccggc
ctgaattccaaacggtttgacgttgttgccaaccaagtcggaaaaacagatcgtgaagac
aaatatgatttctcagataaatacacaacatcaagagccgttgtcgtaacgaaaaaagac
aacaacgatattaagtctgaagcagatgtaaaaggaaaaacgtcagctcaatcactgaca
agcaactacaacaaattagctacaaatgccggcgctaaagtagaaggcgttgaaggcatg
gcgcaggcccttcaaatgatccagcaaggccgcgtcgatatgacatacaacgataagctt
gccgtattgaactacttaaaaacatctggcaataaaaacgtgaaaatcgcgtttgaaaca
ggtgagcctcagtcaacatatttcacgttccgtaaaggaagcggcgaggttgttgatcaa
gtcaacaaagcattaaaagaaatgaaagaggacgggactctttctaaaatttctaaaaaa
tggttcggcgaagatgtttctaaataa

DBGET integrated database retrieval system