KEGG   Bacillus subtilis subsp. subtilis 168: BSU03620Help
Entry
BSU03620          CDS       T00010                                 

Gene name
yclA
Definition
(RefSeq) LysR family transcriptional regulator
  KO
K21755  LysR family transcriptional regulator, salicylic acid-responsive activator of bsdBCD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU03620 (yclA)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    BSU03620 (yclA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR HTH_5
Motif
Other DBs
NCBI-GeneID: 938299
NCBI-ProteinID: NP_388244
Pasteur: BG12022
BSORF: BG12022
UniProt: P94403
Position
complement(411578..412450)
Genome map
AA seq 290 aa AA seqDB search
MDIRQLRYFITIAQEQKITSAAKKLHMAQPPLSRQLKQLEDELGVVLFDRNKKKQMTLTY
EGAVFLKRAKEILHRFEDAVIEVQELKEEVAGTLAVGSTIYCAALMLEKVTQIKERYPHL
TFNIWENEPATLLELLESRQIDAAVTTTLIKSDTVQFKQLDDIPCVLVLSDEAGYPCGDT
IKMVDIPSFPLILLRPVNGKGVYNQVMNEFHRLNLEPRIVCECHDSATLLSLVSSGFGAS
ILPVTMIPVHMRNHVHTVHIENNPFIMTPAVMWRTDSYLPKPAQQFLDLF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttggatattcgccagcttcgatacttcattaccattgcccaagaacagaaaattacgtcc
gcagccaaaaagcttcacatggcgcagccgcctttaagcaggcagctcaaacagctggag
gacgaacttggtgttgttctgtttgaccgtaacaagaaaaaacaaatgactcttacatat
gaaggagctgtttttctaaaaagagcaaaagagattctgcataggtttgaagatgcagtc
attgaggtacaggagctgaaggaggaagtagccggtacacttgccgtgggatcaacgatt
tattgcgcggctctgatgcttgaaaaagtaacacagatcaaagagagatacccccatctc
acctttaatatttgggaaaatgaacccgcgacactgttggaactgctggaaagccggcaa
atcgatgcggcggtcacgacaacactgatcaaaagtgacacagtacaattcaagcagctt
gatgacattccatgtgtgctcgtgctttcagatgaagccggatatccgtgcggagacacc
attaagatggtggacattccttcatttccgctgatcctgctgcggcctgtcaacggaaaa
ggcgtctataatcaggtcatgaatgaatttcatcgtttgaacctggagccgcgcattgtt
tgtgaatgccacgactctgcaactttgctcagcctcgtgtcatccggattcggcgcgtct
attttgcctgtcacaatgattcccgttcatatgagaaatcacgttcacaccgtccatatc
gaaaataatcccttcattatgacaccggctgtcatgtggagaacggacagttatttgcct
aaaccggcacagcaatttttggatttattttaa

DBGET integrated database retrieval system