KEGG   Bacillus subtilis subsp. subtilis 168: BSU03630Help
Entry
BSU03630          CDS       T00010                                 

Gene name
yclB
Definition
(RefSeq) phenolic acid decarboxylase subunit B
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu00627  Aminobenzoate degradation
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU03630 (yclB)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU03630 (yclB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BSU03630 (yclB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 938296
NCBI-ProteinID: NP_388245
Pasteur: BG12023
BSORF: BG12023
UniProt: P94404
Position
412540..413154
Genome map
AA seq 204 aa AA seqDB search
MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLVVSPWANVTIKHETGY
TLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLASIRTGMADNLLTRAADV
MLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFYNRPRSLEEMVDHIVFRT
LDQFGIRLPEAKRWNGIEKQKGGA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagaattcaagcgtaaaggagggggcaaagtgaaactcgttgtcggaatgaca
ggggcaacaggggccattttcggggtcaggctgctgcagtggctgaaggccgccggagtg
gaaacccatctcgttgtgtctccttgggcaaacgtcacgatcaaacacgaaacaggctat
acgttacaagaagtagaacaactggccacatacacttactcacataaggatcaggcggca
gccatttcaagcgggtcgtttgataccgatggaatgattgttgcgccgtgcagcatgaaa
tctctcgcaagcattcgcacaggaatggcggataatctgctgacacgtgcggcggatgtc
atgctcaaggagagaaaaaaactcgtcctcttaacgagagagacgcctttgaaccaaatt
catctcgaaaatatgctagcgcttacgaaaatgggcaccatcattcttcctccgatgccg
gcattttataatcggccgagaagcttagaggaaatggttgaccatattgtttttagaacg
ttggaccaattcggcattcggcttcctgaagcgaagcgctggaatgggattgaaaaacaa
aaaggaggagcttga

DBGET integrated database retrieval system