KEGG   Bacillus subtilis subsp. subtilis 168: BSU03630
Entry
BSU03630          CDS       T00010                                 

Symbol
yclB
Name
(RefSeq) phenolic acid decarboxylase subunit B
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu00627  Aminobenzoate degradation
bsu00740  Riboflavin metabolism
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU03630 (yclB)
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU03630 (yclB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU03630 (yclB)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU03630 (yclB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BSU03630 (yclB)
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-GeneID: 938296
NCBI-ProteinID: NP_388245
Pasteur: BG12023
BSORF: BG12023
UniProt: P94404 A0A6M3ZAI4
Position
412540..413154
AA seq 204 aa
MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLVVSPWANVTIKHETGY
TLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLASIRTGMADNLLTRAADV
MLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFYNRPRSLEEMVDHIVFRT
LDQFGIRLPEAKRWNGIEKQKGGA
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaaagcagaattcaagcgtaaaggagggggcaaagtgaaactcgttgtcggaatgaca
ggggcaacaggggccattttcggggtcaggctgctgcagtggctgaaggccgccggagtg
gaaacccatctcgttgtgtctccttgggcaaacgtcacgatcaaacacgaaacaggctat
acgttacaagaagtagaacaactggccacatacacttactcacataaggatcaggcggca
gccatttcaagcgggtcgtttgataccgatggaatgattgttgcgccgtgcagcatgaaa
tctctcgcaagcattcgcacaggaatggcggataatctgctgacacgtgcggcggatgtc
atgctcaaggagagaaaaaaactcgtcctcttaacgagagagacgcctttgaaccaaatt
catctcgaaaatatgctagcgcttacgaaaatgggcaccatcattcttcctccgatgccg
gcattttataatcggccgagaagcttagaggaaatggttgaccatattgtttttagaacg
ttggaccaattcggcattcggcttcctgaagcgaagcgctggaatgggattgaaaaacaa
aaaggaggagcttga

DBGET integrated database retrieval system