KEGG   Bacillus subtilis subsp. subtilis 168: BSU03640Help
Entry
BSU03640          CDS       T00010                                 

Gene name
ubiD
Definition
(RefSeq) phenolic acid decarboxylase subunit C
  KO
K01612  vanillate/4-hydroxybenzoate decarboxylase subunit C [EC:4.1.1.- 4.1.1.61]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00627  Aminobenzoate degradation
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU03640 (ubiD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.61  4-hydroxybenzoate decarboxylase
     BSU03640 (ubiD)
    4.1.1.-  
     BSU03640 (ubiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiD
Motif
Other DBs
NCBI-GeneID: 938291
NCBI-ProteinID: NP_388246
Pasteur: BG12024
BSORF: BG12024
UniProt: P94405
Position
413157..414578
Genome map
AA seq 473 aa AA seqDB search
MAYQDFREFLAALEKEGQLLTVNEEVKPEPDLGASARAASNLGDKSPALLFNNIYGYHNA
RIAMNVIGSWPNHAMMLGMPKDTPVKEQFFEFAKRYDQFPMPVKREETAPFHENEITEDI
NLFDILPLFRINQGDGGYYLDKACVISRDLEDPDNFGKQNVGIYRMQVKGKDRLGIQPVP
QHDIAIHLRQAEERGINLPVTIALGCEPVITTAASTPLLYDQSEYEMAGAIQGEPYRIVK
SKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGGRSMPIIKIKRVYHRNNPIF
EHLYLGMPWTECDYMIGINTCVPLYQQLKEAYPNEIVAVNAMYTHGLIAIVSTKTRYGGF
AKAVGMRALTTPHGLGYCKMVIVVDEDVDPFNLPQVMWALSTKMHPKHDAVIIPDLSVLP
LDPGSNPSGITHKMILDATTPVAPETRGHYSQPLDSPLTTKEWEQKLMDLMNK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaagatttcagagaatttctcgctgcccttgaaaaagaaggacagctgctt
acagtgaatgaagaggtaaagccggaaccggatttaggggcctccgcacgggcagccagc
aatcttggcgataaaagccctgcgctcttatttaacaacatttacggctatcataacgcg
cgaattgcgatgaatgtcatcggctcttggccaaaccatgccatgatgctgggcatgccg
aaagacacaccggtaaaagaacagttttttgaattcgcaaagcgttatgaccagtttccg
atgccggtcaaacgtgaggaaacagcgccatttcatgaaaatgaaatcacagaagatatc
aatttgttcgatatactgcctcttttcagaattaaccagggtgatggaggctactattta
gacaaagcatgtgtcatttcccgtgatcttgaggaccctgacaacttcggcaaacaaaat
gtcggcatttacagaatgcaagtcaaaggaaaagaccgccttggcattcagcctgtcccg
cagcacgatattgcaatccatctgcgccaagctgaagaacgcggcatcaaccttccggtc
actattgcgctcggctgtgagccggtcattacaacggcggcatcgactccgcttctctat
gatcaatcagaatacgaaatggcaggtgcgattcaaggcgaaccatatcgcatcgtcaaa
tcaaagctgtctgatcttgatgttccgtggggcgctgaagtggtgcttgaaggtgagatt
attgccggagagcgcgaatatgaagggccgttcggtgaattcacaggccattattccggc
ggacgcagcatgccgattatcaaaattaaacgcgtctatcacagaaacaatccgatcttt
gaacatttatacttaggcatgccttggacagaatgcgattacatgatcggcattaacaca
tgcgtgccgctttatcagcagttaaaagaagcgtatccgaacgaaattgtggcagtgaac
gccatgtacacacacggtttaatcgcgattgtttccacaaaaacccgctatggcggattt
gcgaaagcggtcggcatgcgcgcactcacaacgccgcacggactcggctactgcaaaatg
gtcatagtcgttgatgaggatgtcgatccattcaaccttccgcaggtcatgtgggcgctt
tcgaccaaaatgcatccgaaacatgatgcggtcatcattccggacttatctgtcctgccg
cttgatccgggatccaatccatcaggaatcactcacaaaatgattctcgacgccactaca
ccggttgcgccggaaacaagaggccattattcacagccgcttgattctccgctaacaacg
aaagaatgggaacaaaaactaatggacttaatgaataaataa

DBGET integrated database retrieval system