KEGG   Bacillus subtilis subsp. subtilis 168: BSU03651Help
Entry
BSU03651          CDS       T00010                                 

Gene name
bsdD
Definition
(RefSeq) phenolic acid decarboxylase subunit D
  KO
K21759  vanillate/4-hydroxybenzoate decarboxylase subunit D [EC:4.1.1.- 4.1.1.61]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00627  Aminobenzoate degradation
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU03651 (bsdD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.61  4-hydroxybenzoate decarboxylase
     BSU03651 (bsdD)
    4.1.1.-  
     BSU03651 (bsdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hormone_6 OrfB_Zn_ribbon
Motif
Other DBs
NCBI-GeneID: 8302940
NCBI-ProteinID: YP_003097675
UniProt: C0H3U9
Position
414595..414822
Genome map
AA seq 75 aa AA seqDB search
MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESITNPEKYNPAFKIDPKE
TETAIEVPAVPERKA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgcatacatgtcctcgatgcgactcaaaaaagggagaagtcatgagcaaatcgcctgta
gaaggcgcatgggaagtttatcagtgccaaacatgcttttttacatggagatcctgtgaa
ccggaaagcattacaaatcccgaaaaatacaatccagcgtttaaaattgatccaaaggaa
acagaaacagcaattgaagttccggcggtgccggaacgaaaggcttga

DBGET integrated database retrieval system