KEGG   Bacillus subtilis subsp. subtilis 168: BSU03652Help
Entry
BSU03652          CDS       T00010                                 

Gene name
yclD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx
Motif
Other DBs
NCBI-GeneID: 938293
NCBI-ProteinID: NP_388247
UniProt: C0SPB5
Position
414819..415283
Genome map
AA seq 154 aa AA seqDB search
MIRVNCMSDRLFELLDGSCLNEKQHEAFVLQTVSEDGWPHAAMISAGEIIALSRTDIRIA
LWKNTMTSANILRTGKAQFTAWWKGAAYYVKLECAPLPPLKDAEYERDRFSCRIVSVKED
VAKYADLTSGVRIQLHSPEEVLSRWKKTLEDLKR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgatccgcgtgaactgtatgtcagaccgtctctttgagctgcttgacgggagctgcctg
aatgagaagcagcatgaggccttcgttctgcaaacagtatcagaggatggctggccgcat
gccgctatgatcagtgcaggtgaaatcatcgcgctgagccgaactgatatccgaatcgct
ctgtggaaaaacacaatgacttcggccaacatccttcgcacaggaaaagcacagttcacg
gcgtggtggaagggagcggcctattatgtaaagcttgaatgcgcgcctttaccgcctttg
aaagatgccgaatatgaaagagaccgtttttcctgccgcatcgtttcagtgaaagaggac
gttgcgaaatacgctgatttgacttcaggtgtccgtatacagcttcacagccctgaagag
gtgctgagcagatggaaaaagaccctggaagatttaaaacggtaa

DBGET integrated database retrieval system