KEGG   Bacillus subtilis subsp. subtilis 168: BSU03670Help
Entry
BSU03670          CDS       T00010                                 

Gene name
dtpT
Definition
(RefSeq) transporter
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU03670 (dtpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-GeneID: 938295
NCBI-ProteinID: NP_388249
Pasteur: BG12027
BSORF: BG12027
UniProt: P94408
Position
complement(416235..417713)
Genome map
AA seq 492 aa AA seqDB search
MASIDNESIIKSVPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAILLYYLYTETVNGGLG
FDKGTAVAIMSIYGSLVYMSTIIGGWLADRVFGTANTVFYGGIFIMFGHIALAYPGSSIA
FYISMVLIIVGTGLLKPNVSSVVGDLYTKEDPRRDSGFSIFYMGINLGGLLAPLIVGTLG
QKYNYHLGFGAAAVGMLLGLIVFALTRKKNLGLAGSNVPNPLSKKSAIGTGIGVIIVAIA
VIISVQTGVLTIKRFIDLVSILGILIPVIYFIIMFTSKKADKTEKSRLAAYVPLFIGAVM
FWAIQEQGATILAVYADERIRLSLGGFELQSSWFQSLNPLFVVIFAPIFAWLWMKLGKRQ
PSTPVKFSIGIILAGLSFIIMVFPAMQGKEALVSPLWLVLSFLLVVLGELCLSPVGLSVT
TKLAPAAFSAQTMSMWFLTNAAAQAINAQVAGLFDKIPETMYFGTIGLISIVLGGILLLL
SPVIKRAMKGVL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgattgataacgaaagtatcattaaaagcgtcccgcaaaaagggttctttggt
cacccgcgaggactatttacactatttttcaccgaattttgggagcgtttctcttactat
ggaatgagagcaatcttactttactatttgtatacagagacggtaaacggagggctcggc
tttgacaagggcactgcggttgccattatgtcgatttacggatcactcgtatacatgtcc
accattattggcggatggctcgctgaccgggtattcggtaccgcaaacaccgtgttttac
ggcggcatattcattatgttcggccacattgcactcgcctatccgggcagttcgatagca
ttctatatcagtatggtgcttatcattgtcggaacaggcttattaaaaccaaacgtttca
agcgtagttggggatctttacacgaaagaagacccgcgccgcgactcaggtttcagtatt
ttctacatggggattaacctcggtggtttactcgcgccgttaattgtcggaacactcgga
cagaagtacaactatcatctcggattcggagctgccgcggtcggaatgcttctcggactt
atcgtatttgctttgacaagaaagaaaaacctcgggcttgcaggttccaatgtgccgaat
ccgctgtctaaaaaatctgcaattggcaccggaatcggtgttatcattgtggcgatcgca
gtgattatctctgtacaaacaggcgtgctgacgatcaaacgtttcattgaccttgtaagt
attctcggtattttgattcctgtgatttatttcatcatcatgtttacaagcaaaaaagcg
gacaaaacagaaaaatcccgtcttgccgcttacgttcctttgtttatcggtgctgtcatg
ttctgggccattcaggaacagggagcgaccattcttgcggtatacgctgatgaacgcata
agactttcattgggcggattcgaacttcagtcatcatggttccaatcattaaatccattg
tttgttgtcatttttgcgccaatattcgcatggctctggatgaagcttggcaaacgtcag
ccgtctacaccagttaaattctcaatcggaattattttagccggattgtcatttatcatt
atggtattccctgctatgcaaggaaaagaagcactcgtaagcccgctttggctcgttctc
agcttcctgcttgtcgtgcttggagagctgtgcctgtctccagtcggtttatccgtgaca
acgaaactggcaccagctgccttctctgcacagacaatgagtatgtggtttctgacgaac
gcagcagcccaagcgatcaatgcccaagtagccggattgtttgataaaattcctgaaaca
atgtacttcggcaccatcggtttgatttctatcgttcttggcggcattctcctgctgctc
tcgccggtgatcaaacgcgcgatgaaaggggtcttataa

DBGET integrated database retrieval system