KEGG   Bacillus subtilis subsp. subtilis 168: BSU03680Help
Entry
BSU03680          CDS       T00010                                 

Gene name
yclG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 938292
NCBI-ProteinID: NP_388250
Pasteur: BG12028
BSORF: BG12028
UniProt: P94409
Position
417993..419747
Genome map
AA seq 584 aa AA seqDB search
MAEFILNAADFGVPRDGKTDSTERINQCLSTAVSKGYHTVWFPKGTYLIDATLGGDLNQR
FRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENITISGGQIIGERDEHTYA
SAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRGLKTNQDYRTSEQIIIRR
CEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGIDIEGYGEGDVDYEEPINVS
IRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQTVIKGNILRRPEDAAAAPRV
GITGLGVSQGKETSDAVIAGNLITGFSTGIDVRGKSVLVTNNKISNFENTGILVYQSSDV
KVDGNQIQNGLSETRRSIGLRAVLSDDIAFLNNCLIQVVDGVNVSGGNMIIKDNLLRKFS
RGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAGAIIKNNTFKEFKNYPIYCSTSA
KTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRTAGNPIVIYLNGSAGSIISGNTIN
NLSAGTATAIQTNTSTNSKIIGNRIFKGTINKHSSDTIDGNMIV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaattcatattaaatgcagcggatttcggtgttcctagagatggtaaaacggat
tcgacagaacggattaatcagtgcctcagtacagctgtttcgaaaggctatcatactgtc
tggtttccaaagggaacatatttaatagacgcaacgcttggcggagatcttaatcagagg
tttcgaaacgcggggatcattgttcccggcaaccttgagattatgatggaccccgaatgt
atcatgaaagtgataccgaatagttcgtggggttattccgcattttatgtaggcaagcaa
gagaatataactatttccggaggacaaattatcggcgaacgggatgagcatacgtatgcc
tcggcggggataaggtcaacccatgaatggggctttggcatatgtattgaaggatgctcg
aatgttgtcattgatgatgtgaaaatttccgattttaccggcgatgggatcatagtcagc
ccaaggggattaaagaccaatcaagattatcgaacgtcagagcaaattatcatccgccgc
tgtgaggttcggcggtcgaggagaaataacatttccattaccggatgtgacatggtcacg
gtggaggaatgcttgattgaagatgccggaacggggaatggaacagcgccgaaattcgga
attgacattgaaggatatggcgaaggtgacgttgattatgaggaaccgattaatgtatca
attcgcaataaccactttgttggaaacgtttcaagttctgtgaccaattttaacgggtat
ggcattttaatagaaggaaatcactcagacaatacaatcagctacggatatgggacgcaa
acagtgatcaagggcaatattctgagacgccctgaagacgcggcggctgcgccaagagtc
gggataaccggactcggtgtatcacaaggaaaagagaccagtgatgcagtgatcgctggc
aacctcattaccggattttcaactggaattgatgtcaggggaaagagcgttcttgtgacg
aacaacaaaatcagcaactttgaaaacacagggatattggtttatcagtcctccgacgta
aaggtagacggaaaccaaattcaaaacggactgtctgaaacaaggcgcagcatcggtctt
cgcgcagtgctgtcagatgacatcgcatttctgaataactgtctcattcaagtcgttgac
ggtgtgaacgtttccggcggaaatatgatcattaaagataatctcctgagaaaattcagc
cggggcatttggattgctcaagggaacgcggtgattgaagggaatacactgaatcctgac
gcgtttgaagcagtgccggaatcatattctgtttccgtcacaaacaatgccggcgccatc
atcaaaaacaatacatttaaagagttcaaaaattaccccatttattgctccacaagtgca
aaaacctcaattatcggcaaccacttagagcgatccccgcttttggtcaccatctatatc
agcgcaggtgtgcatgagatttttgataataccatttcagtcaacagaacagccgggaat
ccgattgtgatttatctcaatggctctgcaggctctatcatctctggaaacaccatcaat
aacctctccgcgggcactgcgacagctattcaaacaaacacgtcaaccaattccaaaatc
atcggcaaccgcatttttaaagggaccatcaacaaacacagcagtgatacaatagacggc
aatatgattgtctga

DBGET integrated database retrieval system