KEGG   Bacillus subtilis subsp. subtilis 168: BSU03690Help
Entry
BSU03690          CDS       T00010                                 

Gene name
yczF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF588 EpsG ABC_membrane_2 Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 938290
NCBI-ProteinID: NP_388251
Pasteur: BG12780
BSORF: BG12780
UniProt: O31479
Position
complement(419763..419984)
Genome map
AA seq 73 aa AA seqDB search
MKILGVTGFILICLLAISVLMDMLQGFSLTKAVYNNMSSFKMTTFAEWVVLLFFVLVLVR
EMYVIYKSKKKNP
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattgggcgtgaccggattcatattaatttgtttattagctatttctgtgttg
atggacatgcttcaagggttcagtttaacaaaagccgtttataacaatatgtccagcttt
aagatgacaacatttgcggaatgggtcgtgcttttattttttgtgttagtacttgtgaga
gaaatgtacgtgatctataaatcgaaaaaaaagaacccctaa

DBGET integrated database retrieval system