KEGG   Bacillus subtilis subsp. subtilis 168: BSU03690
Entry
BSU03690          CDS       T00010                                 

Symbol
yczF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CASP_dom Virul_fac_BrkB ABC_membrane_2 TssN
Other DBs
NCBI-GeneID: 938290
NCBI-ProteinID: NP_388251
Pasteur: BG12780
BSORF: BG12780
UniProt: O31479 A0A6M4JCX3
Position
complement(419763..419984)
AA seq 73 aa
MKILGVTGFILICLLAISVLMDMLQGFSLTKAVYNNMSSFKMTTFAEWVVLLFFVLVLVR
EMYVIYKSKKKNP
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaagatattgggcgtgaccggattcatattaatttgtttattagctatttctgtgttg
atggacatgcttcaagggttcagtttaacaaaagccgtttataacaatatgtccagcttt
aagatgacaacatttgcggaatgggtcgtgcttttattttttgtgttagtacttgtgaga
gaaatgtacgtgatctataaatcgaaaaaaaagaacccctaa

DBGET integrated database retrieval system