KEGG   Bacillus subtilis subsp. subtilis 168: BSU03700
Entry
BSU03700          CDS       T00010                                 
Symbol
gerKA
Name
(RefSeq) spore germination protein KA
  KO
K06295  spore germination protein KA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU03700 (gerKA)
SSDB
Motif
Pfam: GerA
Other DBs
NCBI-GeneID: 938285
NCBI-ProteinID: NP_388252
Pasteur: BG11392
BSORF: BG11392
UniProt: P49939 A0A6M4JEX2
Position
420110..421744
AA seq 544 aa
MPLFSKRKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIAETKKEVGSSSDVIIR
EIKIGEQDHVHLAVIYISGLVDNNTIHESLIDPLVQDESIQNTHAIQQILEKTLPLGGVK
AEKSWDKLFSELMLGNALIFADGHDEALICSTQGGEQRSIQEPSTQVSFRGPRQGFTESL
QTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDEKVLKEVKQRLEKIDIDSI
LESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAIIVDGTPFVLIAPALFVQFF
QSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTFHQEMIPTQLLVVIAAQREIV
PFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGALVIGQAAVQAGIVSPAMVIIVA
LTAIASFATPAFAMAISARLIRFIFIIASAVMGFYGLILGIIMMFVHLCSLRSFGVPYMS
PLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQGKDQRPEPAASRGMVNKDLEEGD
QNGT
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgcctttattttctaagcgaaagaacaataccgattcaaaagacaagcagaatacagac
gaaaggaatcaggaacagcagcaagaaaaagaaaggccggttctcatttctccaagttta
gcaaagaatatagcggaaacgaaaaaggaagtcggaagcagctctgacgtcatcattcgc
gagattaaaatcggggagcaggatcatgtccacctagctgttatctatatttctgggctg
gtcgataataacacgatccatgagtcgttaattgacccattggtacaggatgagtctatc
cagaatactcatgcgatccagcaaattcttgaaaaaacgctcccgctgggcggggtgaaa
gcggaaaagagctgggacaagcttttttccgagttaatgcttggcaatgcgctcattttt
gctgatggccatgatgaagctttgatttgcagcactcaagggggagagcagcgctccatc
caagagccgagcacccaggtgtcattccgcggcccgcgccaagggtttacagagtctctg
caaaccaatatttccatgatccggcgatacattaaaaatccgaatttatgggttgaaaaa
atgaaaaaaggttctgttacgaatacggatatcgctctcatgtacattcaaggaatatgt
gatgaaaaggtgctgaaggaagtgaaacagcgcctggaaaaaatagatattgacagtatt
ttggaatctggatatattgagcagctgattgaagatgaaacctttacgacgtttccgact
atgtatcatacagaacgccctgatgttgtagcgggtaatctgttagaaggaagattcgcg
attattgtggacggaacaccgtttgtgcttattgccccagccttatttgtccagtttttt
cagtctgttgaggattattattcgcgttttgacattgcgacaagcataagaattcttcgt
gttttagtctttttcatttcgcttgtggcaccagctgtatacgtggcagccacgacgttt
catcaagaaatgataccgactcagctgttagtggtcattgcggcccagcgggaaattgtc
ccgtttccggctgttgtggaggcgctgacgatggaggttgcttttgagattctgagggaa
gcgggagtcaggctgccccgggttgtcggctcggcagtgtcaatcgtaggcgcgctcgta
atcggccaggctgccgtacaggctggtatcgtctctccggcaatggtgattatcgtggca
ctcaccgcgattgcgagcttcgcaacaccggcgtttgcaatggcgatttcagcccggctt
attcggtttatctttattattgcctcagctgttatgggtttttacgggctgattttaggg
atcattatgatgtttgtccacttatgcagtcttcgttcattcggcgttccatatatgtcg
ccgcttgcacctttttcttcacaaggcgtaaaggacgcgcttttccgggttccgtggtgg
gccgatgaaaaaaggccggaatcggtcagcaaggaagataaggtgcggcaggggaaagat
caacgcccagagccggccgcttcacgaggaatggtgaacaaagatttggaagaaggggat
cagaatggtacgtaa

DBGET integrated database retrieval system