KEGG   Bacillus subtilis subsp. subtilis 168: BSU03700Help
Entry
BSU03700          CDS       T00010                                 

Gene name
gerKA
Definition
(RefSeq) spore germination protein KA
  KO
K06295  spore germination protein KA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU03700 (gerKA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerA
Motif
Other DBs
NCBI-GeneID: 938285
NCBI-ProteinID: NP_388252
Pasteur: BG11392
BSORF: BG11392
UniProt: P49939
Position
420110..421744
Genome map
AA seq 544 aa AA seqDB search
MPLFSKRKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIAETKKEVGSSSDVIIR
EIKIGEQDHVHLAVIYISGLVDNNTIHESLIDPLVQDESIQNTHAIQQILEKTLPLGGVK
AEKSWDKLFSELMLGNALIFADGHDEALICSTQGGEQRSIQEPSTQVSFRGPRQGFTESL
QTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDEKVLKEVKQRLEKIDIDSI
LESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAIIVDGTPFVLIAPALFVQFF
QSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTFHQEMIPTQLLVVIAAQREIV
PFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGALVIGQAAVQAGIVSPAMVIIVA
LTAIASFATPAFAMAISARLIRFIFIIASAVMGFYGLILGIIMMFVHLCSLRSFGVPYMS
PLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQGKDQRPEPAASRGMVNKDLEEGD
QNGT
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcctttattttctaagcgaaagaacaataccgattcaaaagacaagcagaatacagac
gaaaggaatcaggaacagcagcaagaaaaagaaaggccggttctcatttctccaagttta
gcaaagaatatagcggaaacgaaaaaggaagtcggaagcagctctgacgtcatcattcgc
gagattaaaatcggggagcaggatcatgtccacctagctgttatctatatttctgggctg
gtcgataataacacgatccatgagtcgttaattgacccattggtacaggatgagtctatc
cagaatactcatgcgatccagcaaattcttgaaaaaacgctcccgctgggcggggtgaaa
gcggaaaagagctgggacaagcttttttccgagttaatgcttggcaatgcgctcattttt
gctgatggccatgatgaagctttgatttgcagcactcaagggggagagcagcgctccatc
caagagccgagcacccaggtgtcattccgcggcccgcgccaagggtttacagagtctctg
caaaccaatatttccatgatccggcgatacattaaaaatccgaatttatgggttgaaaaa
atgaaaaaaggttctgttacgaatacggatatcgctctcatgtacattcaaggaatatgt
gatgaaaaggtgctgaaggaagtgaaacagcgcctggaaaaaatagatattgacagtatt
ttggaatctggatatattgagcagctgattgaagatgaaacctttacgacgtttccgact
atgtatcatacagaacgccctgatgttgtagcgggtaatctgttagaaggaagattcgcg
attattgtggacggaacaccgtttgtgcttattgccccagccttatttgtccagtttttt
cagtctgttgaggattattattcgcgttttgacattgcgacaagcataagaattcttcgt
gttttagtctttttcatttcgcttgtggcaccagctgtatacgtggcagccacgacgttt
catcaagaaatgataccgactcagctgttagtggtcattgcggcccagcgggaaattgtc
ccgtttccggctgttgtggaggcgctgacgatggaggttgcttttgagattctgagggaa
gcgggagtcaggctgccccgggttgtcggctcggcagtgtcaatcgtaggcgcgctcgta
atcggccaggctgccgtacaggctggtatcgtctctccggcaatggtgattatcgtggca
ctcaccgcgattgcgagcttcgcaacaccggcgtttgcaatggcgatttcagcccggctt
attcggtttatctttattattgcctcagctgttatgggtttttacgggctgattttaggg
atcattatgatgtttgtccacttatgcagtcttcgttcattcggcgttccatatatgtcg
ccgcttgcacctttttcttcacaaggcgtaaaggacgcgcttttccgggttccgtggtgg
gccgatgaaaaaaggccggaatcggtcagcaaggaagataaggtgcggcaggggaaagat
caacgcccagagccggccgcttcacgaggaatggtgaacaaagatttggaagaaggggat
cagaatggtacgtaa

DBGET integrated database retrieval system