KEGG   Bacillus subtilis subsp. subtilis 168: BSU03710
Entry
BSU03710          CDS       T00010                                 
Symbol
gerKC
Name
(RefSeq) spore germination protein KC
  KO
K06297  spore germination protein KC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU03710 (gerKC)
SSDB
Motif
Pfam: Spore_GerAC
Other DBs
NCBI-GeneID: 938287
NCBI-ProteinID: NP_388253
Pasteur: BG11394
BSORF: BG11394
UniProt: P49941 A0A6M4JFF9
Position
421734..422957
AA seq 407 aa
MVRKCLLAVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNDSNYVLHLQIINPGNVAG
GLQGGGAGDRPPVSVYSIEGNNITEALRKASMKVSRRLYFAHTNLVVINEKLAKEEGLDF
VLDNLDRDTEFRTTATFVVAHKTKAENIVKILTPIDKIPSNKVNKTLDFTEAQYGRVVKI
NIQDVLKTLAANTMAPVIPGYMMIGDDKKGVSMENTQATDPKAILQADGLAVFDKAGYLK
YWLEDDESVGAVWLMNKIQHTFINADWGKTKDAVSLQVTHQDTKLVPKMRNGRPYIHVKV
SVEGIIDAVKYPFQLSDPKVLAAIEKALNKELEKEISHTVKKIKKNKIDFIGFGDTIYRK
YPEQWEKMKDTWDKEYLPELPIDVKAETYIRRTGLRNNPIKHQFKDD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggtacgtaaatgtctattagccgttctcatgcttttgagcgtcattgtgctgcccggc
tgctgggataagcgggagctgacggatcttgcgattatctcggcgattggcatcgatcgg
acaaacgacagcaactacgtgctgcatcttcaaattatcaatccaggaaatgttgccggc
ggccttcagggaggcggtgctggagacaggccgcctgtatctgtctattcgattgaaggt
aacaatataacggaagcactcagaaaagcctccatgaaggtatcacggcggctttatttt
gcccataccaatctagtcgtgatcaatgaaaagctggcaaaagaagaaggtttggatttt
gtattagataatcttgaccgggacacagaattcaggacaacagcaacattcgtcgttgcc
cataaaacaaaagcagaaaatattgtgaaaatcttgacgccgattgataaaattccgtca
aataaagtcaataaaacactcgatttcacggaggcacaatacgggcgggtggtcaaaatc
aatattcaggacgttttgaaaacacttgccgccaacactatggcaccggtcatccccgga
tatatgatgattggtgacgataaaaaaggagtcagcatggaaaacacgcaggcgactgac
ccgaaagccattcttcaggcagatggtttggcggtttttgataaggcaggatatttaaag
tattggctggaagatgatgaaagcgtgggggcagtctggcttatgaataagatccagcat
acgtttattaatgctgactggggcaagacgaaggatgcggtcagcttgcaggttacccat
caagatacaaagctggtaccgaaaatgcggaacggacgcccgtacatccatgtgaaagtg
tcggttgaaggtattatagatgctgtcaaataccctttccaattgtctgatcccaaggtg
ctggccgctattgaaaaagcgctcaacaaagagcttgaaaaggaaatcagccatactgtg
aaaaagattaagaagaataaaatagattttatcggttttggtgacacgatatatagaaag
tatccggagcagtgggagaaaatgaaggacacttgggacaaagaatatttgccggaactg
cccatcgatgtgaaggccgagacgtatatcagaaggacgggattgcgaaacaatccgatc
aaacaccagtttaaagatgattag

DBGET integrated database retrieval system