KEGG   Bacillus subtilis subsp. subtilis 168: BSU03710Help
Entry
BSU03710          CDS       T00010                                 

Gene name
gerKC
Definition
(RefSeq) spore germination protein KC
  KO
K06297  spore germination protein KC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU03710 (gerKC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_GerAC
Motif
Other DBs
NCBI-GeneID: 938287
NCBI-ProteinID: NP_388253
Pasteur: BG11394
BSORF: BG11394
UniProt: P49941
Position
421734..422957
Genome map
AA seq 407 aa AA seqDB search
MVRKCLLAVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNDSNYVLHLQIINPGNVAG
GLQGGGAGDRPPVSVYSIEGNNITEALRKASMKVSRRLYFAHTNLVVINEKLAKEEGLDF
VLDNLDRDTEFRTTATFVVAHKTKAENIVKILTPIDKIPSNKVNKTLDFTEAQYGRVVKI
NIQDVLKTLAANTMAPVIPGYMMIGDDKKGVSMENTQATDPKAILQADGLAVFDKAGYLK
YWLEDDESVGAVWLMNKIQHTFINADWGKTKDAVSLQVTHQDTKLVPKMRNGRPYIHVKV
SVEGIIDAVKYPFQLSDPKVLAAIEKALNKELEKEISHTVKKIKKNKIDFIGFGDTIYRK
YPEQWEKMKDTWDKEYLPELPIDVKAETYIRRTGLRNNPIKHQFKDD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtaaatgtctattagccgttctcatgcttttgagcgtcattgtgctgcccggc
tgctgggataagcgggagctgacggatcttgcgattatctcggcgattggcatcgatcgg
acaaacgacagcaactacgtgctgcatcttcaaattatcaatccaggaaatgttgccggc
ggccttcagggaggcggtgctggagacaggccgcctgtatctgtctattcgattgaaggt
aacaatataacggaagcactcagaaaagcctccatgaaggtatcacggcggctttatttt
gcccataccaatctagtcgtgatcaatgaaaagctggcaaaagaagaaggtttggatttt
gtattagataatcttgaccgggacacagaattcaggacaacagcaacattcgtcgttgcc
cataaaacaaaagcagaaaatattgtgaaaatcttgacgccgattgataaaattccgtca
aataaagtcaataaaacactcgatttcacggaggcacaatacgggcgggtggtcaaaatc
aatattcaggacgttttgaaaacacttgccgccaacactatggcaccggtcatccccgga
tatatgatgattggtgacgataaaaaaggagtcagcatggaaaacacgcaggcgactgac
ccgaaagccattcttcaggcagatggtttggcggtttttgataaggcaggatatttaaag
tattggctggaagatgatgaaagcgtgggggcagtctggcttatgaataagatccagcat
acgtttattaatgctgactggggcaagacgaaggatgcggtcagcttgcaggttacccat
caagatacaaagctggtaccgaaaatgcggaacggacgcccgtacatccatgtgaaagtg
tcggttgaaggtattatagatgctgtcaaataccctttccaattgtctgatcccaaggtg
ctggccgctattgaaaaagcgctcaacaaagagcttgaaaaggaaatcagccatactgtg
aaaaagattaagaagaataaaatagattttatcggttttggtgacacgatatatagaaag
tatccggagcagtgggagaaaatgaaggacacttgggacaaagaatatttgccggaactg
cccatcgatgtgaaggccgagacgtatatcagaaggacgggattgcgaaacaatccgatc
aaacaccagtttaaagatgattag

DBGET integrated database retrieval system