KEGG   Bacillus subtilis subsp. subtilis 168: BSU03720
Entry
BSU03720          CDS       T00010                                 

Symbol
gerKB
Name
(RefSeq) spore germination protein KB
  KO
K06296  spore germination protein KB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03720 (gerKB)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU03720 (gerKB)
SSDB
Motif
Pfam: Spore_permease
Other DBs
NCBI-GeneID: 938282
NCBI-ProteinID: NP_388254
Pasteur: BG11393
BSORF: BG11393
UniProt: P49940 A0A6M3ZAJ4
Position
422982..424103
AA seq 373 aa
MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCAIGLFLFYLYQGIYQC
YPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEMLLTFAYHDTPIIIVNA
LLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSGTIDPHNLKPVLANGISP
VLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMAISGLIVALTVAINISVLD
VDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFFKVSLYLYATVVGTSTLFKE
KNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYIHLPFQLLFPLFLFIVAVWKK
KRREKSKGEEAKK
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggaaaaagccagaataagcataaggcagttgtttgtcatgattatcatttttgaactg
ggcagctccttattgattacaccgggatcaatggcgggcagggatgcttggatagcagtt
ttattaggctgtgcgatcggactgtttcttttctatttgtatcaaggcatttatcaatgt
tatccgaattcttctccgaaagaatatatggatgatatgctgggaaccaagctgagctgg
ctgttttcatttctctatatcttgtactttgcctatattgccgcaagggtgctgcgtgac
tttggagaaatgctgctgacgtttgcttatcatgatacacctatcattattgtaaatgct
ttattaatggtagtaagcatatatgccgtaagaaaaggaattgaagtactcgcacgcgcg
gccgaacttcttttcggggccatgtatttactgggcgcgatcggccttgtgctgattatt
gtctcagggactatagacccgcacaatttaaagccggttttggcaaacggcatttctcct
gtccttcactctgttttcacacagaccatgtacgttccatttggtgaagttgttttattt
gtgatgattttccctaacctgaatgacagaaaagatgtgaaaaaaatggggatgatcgcc
atggctattagcggattgattgtggcgctcaccgtggcgattaatattagcgtgcttgat
gttgatcttacactcagatcccagtttccgcttttaagcacgatccagacaatcaaggtc
gaagaatttttagaccggctcgatgtcttttttatgctggcgctgatcatcggcggcttc
tttaaggtcagcctctacttatatgccactgtggttgggacatctacgctctttaaggaa
aagaacccctctcaattggcttatccgatgggattgggcatcttaatcctttctataacg
atcgcgactaacttttcggagcacttgaatgaaggcctgaacgtggtgccgctgtatatt
catttgccttttcaattattgtttccgctctttctgtttattgtggccgtttggaaaaag
aaacgaagagagaagtcaaaaggggaggaagcaaaaaaatga

DBGET integrated database retrieval system