KEGG   Bacillus subtilis subsp. subtilis 168: BSU03720Help
Entry
BSU03720          CDS       T00010                                 

Gene name
gerKB
Definition
(RefSeq) spore germination protein KB
  KO
K06296  spore germination protein KB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03720 (gerKB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU03720 (gerKB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease
Motif
Other DBs
NCBI-GeneID: 938282
NCBI-ProteinID: NP_388254
Pasteur: BG11393
BSORF: BG11393
UniProt: P49940
Position
422982..424103
Genome map
AA seq 373 aa AA seqDB search
MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCAIGLFLFYLYQGIYQC
YPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEMLLTFAYHDTPIIIVNA
LLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSGTIDPHNLKPVLANGISP
VLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMAISGLIVALTVAINISVLD
VDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFFKVSLYLYATVVGTSTLFKE
KNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYIHLPFQLLFPLFLFIVAVWKK
KRREKSKGEEAKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagccagaataagcataaggcagttgtttgtcatgattatcatttttgaactg
ggcagctccttattgattacaccgggatcaatggcgggcagggatgcttggatagcagtt
ttattaggctgtgcgatcggactgtttcttttctatttgtatcaaggcatttatcaatgt
tatccgaattcttctccgaaagaatatatggatgatatgctgggaaccaagctgagctgg
ctgttttcatttctctatatcttgtactttgcctatattgccgcaagggtgctgcgtgac
tttggagaaatgctgctgacgtttgcttatcatgatacacctatcattattgtaaatgct
ttattaatggtagtaagcatatatgccgtaagaaaaggaattgaagtactcgcacgcgcg
gccgaacttcttttcggggccatgtatttactgggcgcgatcggccttgtgctgattatt
gtctcagggactatagacccgcacaatttaaagccggttttggcaaacggcatttctcct
gtccttcactctgttttcacacagaccatgtacgttccatttggtgaagttgttttattt
gtgatgattttccctaacctgaatgacagaaaagatgtgaaaaaaatggggatgatcgcc
atggctattagcggattgattgtggcgctcaccgtggcgattaatattagcgtgcttgat
gttgatcttacactcagatcccagtttccgcttttaagcacgatccagacaatcaaggtc
gaagaatttttagaccggctcgatgtcttttttatgctggcgctgatcatcggcggcttc
tttaaggtcagcctctacttatatgccactgtggttgggacatctacgctctttaaggaa
aagaacccctctcaattggcttatccgatgggattgggcatcttaatcctttctataacg
atcgcgactaacttttcggagcacttgaatgaaggcctgaacgtggtgccgctgtatatt
catttgccttttcaattattgtttccgctctttctgtttattgtggccgtttggaaaaag
aaacgaagagagaagtcaaaaggggaggaagcaaaaaaatga

DBGET integrated database retrieval system