KEGG   Bacillus subtilis subsp. subtilis 168: BSU03730Help
Entry
BSU03730          CDS       T00010                                 

Gene name
yclH
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03730 (yclH)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BSU03730 (yclH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_15 SMC_N AAA_23 AAA_22 SbcCD_C AAA_29 PhoH KDGP_aldolase RsgA_GTPase ATPase AAA_24
Motif
Other DBs
NCBI-GeneID: 938289
NCBI-ProteinID: NP_388255
Pasteur: BG12029
BSORF: BG12029
UniProt: P94411
Position
complement(424208..424888)
Genome map
AA seq 226 aa AA seqDB search
MSLLQFQQVGYWYKNKSQPLFQDINISFQKGKFYTIVGTSGTGKTTFLSLAGGLDAPKEG
NILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTAMEITGSKEKNKESYAL
DMLQKVGINEKQARQKVLTLSGGQQQRVSITRAFCCDTDLIVADEPTGNLDEDTSKEIVR
LFQDLAHKEDKCVIMVTHDEQIAKVSDINIRLSRGSFTVKENVAVV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagcttattacaatttcaacaagtcggctactggtataaaaacaaaagccagccattg
tttcaggatattaacatcagctttcaaaaaggaaaattctacacaatcgtcggaacatca
gggacggggaaaaccactttcctgtctctggcaggcggacttgacgcaccaaaagaagga
aacatcctttacgacggaaaagcggtttctaaaatcggcttaaccaatttcagaaatcaa
tatgtatcaatcgtctttcaggcgtacaacctgctcccgtatatgacggctttgcagaac
gtcacaaccgctatggaaatcacaggttctaaagaaaagaacaaagaatcatatgcgctt
gacatgctgcagaaggttggcatcaacgaaaaacaagcccggcaaaaagtgctcacactg
agcggcggacagcagcagcgggtatcaattacaagggctttctgctgtgacacggatctt
atcgtagccgatgaaccgaccggaaaccttgatgaggacacatcaaaagagatcgtacgg
ctctttcaggatctggcgcacaaggaagataaatgcgtcattatggtgacgcacgatgaa
caaattgcaaaagtgtcagacatcaatatcagactttcaagaggaagttttactgtgaag
gaaaacgtcgcagtcgtataa

DBGET integrated database retrieval system