KEGG   Bacillus subtilis subsp. subtilis 168: BSU03760Help
Entry
BSU03760          CDS       T00010                                 

Gene name
yclK
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_5 DUF4164 DUF5552 Caudo_TAP
Motif
Other DBs
NCBI-GeneID: 938283
NCBI-ProteinID: NP_388258
Pasteur: BG12032
BSORF: BG12032
UniProt: P94414
Position
427247..428668
Genome map
AA seq 473 aa AA seqDB search
MMKIKYLYQLLLSHISILILAFVIIISLFSHFVKEFAYQNKVEELTSYAVQIANEFQSGQ
VDMRRLYPYQDILSTRKTQFIIFNEEQQPYFLPEGFHHPPREQLKKSEWNKLKKGQTVTI
RADGRFDDEVSLVAQPIFVQNEFKGAVLLISPISGVEQMVNQVNLYMFYAVISTLVITIL
VSWLLSKFHVKRIQKLREATDKVASGDYDIHLENSYGDEIGVLASDFNIMAKKLKQSRDE
IERLEKRRRQFIADVSHELKTPLTTINGLVEGLNSHTIPEDKKDKCFSLISEETKRMLRL
VKENLDYEKIRSQQITLNKLDVPLIEVFEIVKEHLQQQAEEKQNKLMIQVEDHVIVHADY
DRFIQILVNITKNSIQFTQNGDIWLRGMEGYKETIIEIEDTGIGIPKEDIEHIWERFYKA
DISRTNTAYGEYGLGLSIVRQLVEMHQGTVEIKSEEGKGTKFIIRLPLTAKQQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaagattaaatatttatatcagctgctgctaagccatatcagcattttgatttta
gcgtttgtcattatcatttctctgttttcccactttgtgaaggaatttgcctatcagaac
aaagtagaggaattgacgtcatatgcggtgcagattgcaaatgaattccaatccggccag
gtggacatgcgcaggctctatccttatcaggacattttaagcacaagaaagacgcaattt
atcatctttaatgaagagcagcagccttattttcttcctgaaggctttcatcacccacca
agggaacagctgaagaaatcagaatggaataagctgaaaaaagggcagactgtcacgatc
agggcagatggccgttttgatgatgaagtgtcccttgtggcgcagcctatatttgttcag
aacgaatttaaaggcgccgttctgctgatttctccgatcagcggtgttgaacagatggtc
aatcaggtcaacctctatatgttttacgctgtgatcagcacgcttgtgattacgattctt
gtgagctggcttctgtccaaattccatgtcaagcggattcaaaagctgagagaagcgaca
gataaagtggcttccggcgattatgacatccatttggaaaacagctacggggacgaaatc
ggcgtactggcgtctgactttaatatcatggcgaaaaaactaaagcagtcaagggatgaa
atcgagcgccttgagaagcggagaaggcagtttatcgctgacgtgtcacatgaattaaaa
acaccgctgacgacgatcaacggtttggttgaagggttgaacagccatacgattcctgag
gataaaaaggataaatgcttctcgctgatcagtgaggaaacgaagcgcatgctgcggctc
gtaaaagaaaatctggattatgaaaaaatcagatcccagcaaattaccttgaacaagcta
gacgttcctctgatcgaggtgtttgaaatcgtgaaagagcacttgcagcagcaggcggaa
gaaaaacaaaacaagctgatgatccaagtagaggatcacgtcatcgtacatgccgattat
gaccggttcattcaaattctcgtcaacattacgaaaaacagcatccaatttacgcaaaac
ggtgacatttggctgcgcggaatggaaggttataaagagacgattattgaaattgaagac
acgggtatcggcattccaaaagaggatattgagcatatttgggagcgattctataaagca
gatatttcaagaacgaacacagcatacggtgaatacggactcggtctctcgatcgtcagg
cagctcgttgaaatgcaccagggcacagtagaaatcaagagtgaagaagggaaaggcaca
aagttcatcatccgccttcctttaacggcaaaacagcaatag

DBGET integrated database retrieval system