KEGG   Bacillus subtilis subsp. subtilis 168: BSU03770Help
Entry
BSU03770          CDS       T00010                                 

Gene name
rapC
Definition
(RefSeq) response regulator aspartate phosphatase C
  KO
K06361  response regulator aspartate phosphatase C [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU03770 (rapC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU03770 (rapC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RapH_N TPR_12 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_16 TPR_10 TPR_7 TPR_6 TPR_14 ANAPC3
Motif
Other DBs
NCBI-GeneID: 938284
NCBI-ProteinID: NP_388259
Pasteur: BG11966
BSORF: BG11966
UniProt: P94415
Position
428831..429979
Genome map
AA seq 382 aa AA seqDB search
MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQHDSNLLLYYSLMEFR
HQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYVNFFRGMYEFDKREFIS
AITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLINIKNAYEIYVEQETYNV
RIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLVGRAYYNLGLCYYNQDLLD
PAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDKASEYHKRGYEYAKETDDAD
YAVKFEFLQSLYLDQPNEEGIERCFQYLKNKNMYADIEDLALEVAKYYYEQKWFKLSASY
FLQVEEARKQIQRSEGLYEIEI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtggggtaattccttcttcagcggtcggtcaaaaaattaacgagtggtacaga
tatatccggacattcagcgtgccggatgccgaagtgttaaaagctgaaatccagcaggaa
ctgaaacacatgcagcatgattccaacttgctgctttattattcactaatggaattccgg
caccagcttatgctggattatcttgagccgttagagaaattaaatatcgaagaccagcca
agcctgtctgaattatcaagaaacattgacagcaaccaggcagatctcaaagggctgctc
gactattacgtgaatttttttcgcgggatgtatgaatttgataagcgggaatttatttct
gccattacatactataaacaggcggagaaaaagctctcctttgtcgcagaccatattgaa
cgggctgaattctattttaaaatcgcggaagcttattattatatgaagcaaacgtatttt
tcattgattaatataaaaaacgcctatgaaatttacgtggagcaggaaacctataatgtg
agaatcattcagtgccatttcgtcttcggggtcaacctgatggatgaaagaaatttcgaa
caagccgcacgccatttcaaattggcgctcaacatggcccaagcagaacaaaaagcccag
ctggttggaagagcatactacaatctcgggttatgctattacaatcaagaccttctagac
cctgccattgattactttgaaaaagcggtctccacatttgaaagcagcaggatcgtcaat
tctctcccgcaagcctattttttaatcaccctgatttattataaacagggaaaacatgat
aaagcttcggaatatcacaagcggggctatgaatatgctaaagaaacagacgatgcagac
tatgccgtaaaattcgagtttttgcaatccctatatctggatcagcccaatgaagaagga
atcgaacgatgtttccagtacttaaaaaataaaaatatgtacgctgatatagaggattta
gccctagaagtagcaaaatattactatgaacagaaatggtttaaactgtctgcttcctac
tttctacaagttgaagaggcaagaaaacaaatacaaaggagtgaaggtttgtatgaaatt
gaaatctaa

DBGET integrated database retrieval system