KEGG   Bacillus subtilis subsp. subtilis 168: BSU03790Help
Entry
BSU03790          CDS       T00010                                 

Gene name
yclM
Definition
(RefSeq) aspartokinase 3
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00261  Monobactam biosynthesis
bsu00270  Cysteine and methionine metabolism
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU03790 (yclM)
   00270 Cysteine and methionine metabolism
    BSU03790 (yclM)
   00300 Lysine biosynthesis
    BSU03790 (yclM)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU03790 (yclM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     BSU03790 (yclM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT
Motif
Other DBs
NCBI-GeneID: 938276
NCBI-ProteinID: NP_388261
Pasteur: BG12033
BSORF: BG12033
UniProt: P94417
Position
complement(430623..431987)
Genome map
AA seq 454 aa AA seqDB search
MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAEDTKVTDLLIACAEQYL
ATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVENPKEISE
LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
IASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEHVPSGIDDMTIILRQGQMDAA
TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttaaattcggaggcagctcacttgcttcaggcgcccagcttgacaaggtg
tttcacatcgttacctcagatccggcacggaaagctgtagtcgtttcagctccgggaaaa
cactatgccgaggatacgaaagtgactgatctcttaatcgcatgtgcagaacaatatttg
gcaacaggcagcgcacctgaactggcggaagctgttgtggaacggtacgctctcatcgcc
aatgagcttcagctggggcaaagcattatcgaaaaaatcagagatgatctgtttacgctt
ttagaaggagacaaaagcaatcccgaacaataccttgacgcagtcaaggccagcggagag
gataacaatgccaaactgatcgccgcttacttccgttataaaggcgtcaaagcggaatat
gtaaacccgaaggatgccggcctctttgtgacaaatgaacccggcaacgcgcaagttctt
cctgaatcctatcaaaacctctatcgtcttcgggaacgtgacggactcatcatttttccc
ggttttttcggattcagcaaggatggcgatgtgatcacattctcacggagcggttctgat
attaccggttcgattcttgccaacggactacaagccgatttgtacgaaaactttacagac
gtagacgctgtgtattctgtcaatccgtccttcgttgagaatccaaaggaaatcagcgag
ctgacatatagagagatgcgggagctgtcctacgcgggtttttcagtgtttcatgatgaa
gcgctcattccggcattcagagcggggattcctgttcagatcaaaaatacgaacaacccc
tcagccgaaggcacccgcgtcgtcagcaagcgggataacacaaacgggcctgtcgtcggc
attgccagcgacaccggtttttgcagcatttatatcagcaagtatctcatgaacagagaa
atcggttttggccgcagagcccttcaaatcctggaggagcatggtttgacgtatgagcat
gttccatcgggaatcgatgacatgacaatcattttacggcaggggcaaatggatgccgcc
actgaacgcagcgtcatcaaacggatcgaagaggatttgcatgccgatgaagtcatcgtc
gagcatcatctcgccctgattatggttgtaggggaagcgatgcgccacaatgtcggtaca
acggcaagagccgccaaagcattatcagaggcacaggtgaatatcgaaatgatcaatcag
gggtcttctgaagtgagcatgatgtttggcgtaaaagaagccgaagaaagaaaagccgtt
caagcgttataccaggaatttttcgcgggcgtgctgatctcttaa

DBGET integrated database retrieval system