KEGG   Bacillus subtilis subsp. subtilis 168: BSU03800Help
Entry
BSU03800          CDS       T00010                                 

Gene name
yclN
Definition
(RefSeq) ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03800 (yclN)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU03800 (yclN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-GeneID: 938273
NCBI-ProteinID: NP_388262
Pasteur: BG12034
BSORF: BG12034
UniProt: P94418
Position
432372..433322
Genome map
AA seq 316 aa AA seqDB search
MKLRYLFILLIILAVTSVFIGVEDLSPLDLFDLSKQEASTLFASRLPRLISIVIAGLSMS
ICGLIMQQISRNKFVSPTTAGTMDWARLGILISLLLFTSASPLIKMLVAFVFALAGNFLF
MKILERIKFNDTIFIPLVGLMLGNIVSSIATFIAYKYDLIQNVSSWLQGDFSLVVKGRYE
LLYLSIPLVIIAYVYADKFTLAGMGESFSVNLGLKYKRVVNIGLIIVSLITSLVILTVGM
LPFLGLIIPNIVSIYRGDNLKSSLPHTVLLGAVFVLFCDILGRIIIFPYEISIGLMVGII
GSGIFLFMLLRRKAYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacgttacttatttattctacttatcatattagcagtcacatctgtatttatc
ggtgtagaagatctgtcgccgcttgatctcttcgatttaagcaaacaagaggcgtcaacg
ctgtttgcaagccgtttgccgcgattgatcagcattgtcattgcgggattaagcatgagc
atctgcggtttgattatgcagcagatcagcagaaataaattcgtgtcaccgacgacggcg
ggcacgatggattgggcgaggctcggcattttaatttccttgctgctgtttacatccgcc
agtcctttaatcaaaatgctggtcgcgtttgtctttgcccttgcaggaaattttctgttt
atgaaaatccttgaaagaatcaagtttaacgacaccatctttattccgcttgtcggttta
atgctcgggaatatcgtcagttcaatcgcgacatttatcgcatataaatatgacttgatc
cagaatgtgtcatcatggctgcagggagacttctctttagtcgtgaaaggaagatacgag
cttctttatctgagtattccgctcgtcatcattgcctatgtgtatgcggataaattcaca
ttggccggtatgggtgaaagcttttctgtcaacctcggcctcaagtataaacgggttgtg
aacatcgggctcattatcgtgtccctgatcacgtctcttgtcattttgactgtcggtatg
ctgccgtttctcggtttaatcatcccgaatattgtatcgatttacagaggagacaatctg
aagagcagcctgccgcatactgtgctgttgggagcggtttttgtgctgttttgcgatata
ctgggcagaatcattatcttcccttatgaaatctcgattggcctgatggtcggaatcatc
ggcagcggcattttcctgtttatgctgttaaggagaaaagcctatgcgtaa

DBGET integrated database retrieval system