KEGG   Bacillus subtilis subsp. subtilis 168: BSU03810Help
Entry
BSU03810          CDS       T00010                                 

Gene name
yclO
Definition
(RefSeq) ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03810 (yclO)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU03810 (yclO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3 7TMR-DISM_7TM
Motif
Other DBs
NCBI-GeneID: 938280
NCBI-ProteinID: NP_388263
Pasteur: BG12035
BSORF: BG12035
UniProt: P94419
Position
433315..434262
Genome map
AA seq 315 aa AA seqDB search
MRNQMKIALLVGLAIVCIGLFLFYDLGNWDYTLPRRIKKVAAIVLTGGAIAFSTMIFQTI
TNNRILTPSILGLDSLYMLIQTGIIFLFGSANMVIMNKNINFIISVLLMILFSLVLYQIM
FKGEGRNIFFLLLIGIVFGTLFSSLSSFMQMLIDPNEFQVVQDKMFASFNNINTDLLWLA
FIIFLLTGVYVWRFTKFFDVLSLGREHAVNLGIDYDKVVKQMLIVVAILVSVSTALVGPI
MFLGLLVVNLAREFLKTYKHSYLIAGSVFISIIALVGGQFVVEKVFTFSTTLSVIINFAG
GIYFIYLLLKENKSW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaccagatgaaaatagctttgctcgttggtttagccattgtatgtattggcttg
tttttgttttatgacttaggcaattgggattacaccctgccgagacgaatcaaaaaagtc
gctgccattgtgctgactgggggagcgattgcgttttcgaccatgatctttcaaacgatt
acgaacaaccgcatcctgacgccgagcattttgggccttgattctctctacatgctgatt
cagactggcattatctttttgttcggttctgcgaatatggtcatcatgaataaaaacatc
aactttatcatctctgttctgctgatgatcctgttttctcttgttttgtatcagatcatg
ttcaagggtgaggggagaaatatctttttccttctgcttatcggaatcgtgtttggcacg
ctgttcagcagcctgtcttcttttatgcagatgctgattgatccgaacgagttccaagtt
gtgcaggacaagatgtttgccagctttaacaatatcaatacggatttgttatggctcgcg
ttcatcatcttcctgctgacaggcgtttatgtctggcgttttacaaaatttttcgatgtg
ctgtcgctcggacgcgagcacgccgtgaatttgggcattgactacgacaaagtggtgaag
cagatgctgatcgtggttgcgattttggtttctgtttcaacagcgctagtcgggccgatt
atgtttttaggccttctggtcgtcaacctggcgagagaattcctgaaaacatataagcat
tcatacttaatcgcaggctccgttttcatcagcatcattgcgctggtcggagggcagttt
gtggttgagaaagtgtttaccttctcaacgacgctgagcgtcattattaattttgccggc
gggatttattttatctacttgctgttaaaggagaataaatcatggtag

DBGET integrated database retrieval system